(data stored in ACNUC7421 zone)

EMBL: CP001700.PE331

CP001700.PE331       Location/Qualifiers
FT   CDS             complement(372303..373931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO4070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69286"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD0"
FT                   /inference="similar to AA sequence:KEGG:SCO4070"
FT                   /protein_id="ACU69286.1"
FT                   /translation="MHVPSRRQSLLILGGLGLAATAGGAYLLENHGGGSGKPAANPPKP
FT                   QPQPQARGRAKSTYGTGDANEGQEGEPSNATGETVPSLALALADDGAWRPDATGYLAVD
FT                   DEGHQIKGFASATSINVGESIDFHISVRPAQSFTVKVYRIGRSAAGKGSELVFTSAKVT
FT                   GKVQPALKVVAPTRTVVAPWQLSYTLNVPNTWRGGLYVATLETADKYRSCIPFVVREDG
FT                   KPADLLVVLPFTTYQAYNMYPVDKALGASLYNAYQPDGREGGADICATRVSFDRPYHQD
FT                   GLPRLFELDQAFAQWVEAQPYTISYASSIDLHAGRIDPAKYKALVFSGHDEYWTPQMRA
FT                   VLQGALSRGVSAAFMAANNVYWNIRLDASQGGSQYRQVTCYKRRPDPAATGSVAPTVLW
FT                   RDLNQPEQQVLGSMYTAIITDTQPQPLVVGETGHWFWAGTGLKNGEQIPRLVAGEADKV
FT                   FPHVKGGPKTTVLATSPFTAEGPKNTPVKDTQQTVLSQYPSGAWMFNAGTFHWNHGLST
FT                   PGFVDVRIQRATRNLLDRMTGKRSA"
     MHVPSRRQSL LILGGLGLAA TAGGAYLLEN HGGGSGKPAA NPPKPQPQPQ ARGRAKSTYG        60
     TGDANEGQEG EPSNATGETV PSLALALADD GAWRPDATGY LAVDDEGHQI KGFASATSIN       120
     VGESIDFHIS VRPAQSFTVK VYRIGRSAAG KGSELVFTSA KVTGKVQPAL KVVAPTRTVV       180
     APWQLSYTLN VPNTWRGGLY VATLETADKY RSCIPFVVRE DGKPADLLVV LPFTTYQAYN       240
     MYPVDKALGA SLYNAYQPDG REGGADICAT RVSFDRPYHQ DGLPRLFELD QAFAQWVEAQ       300
     PYTISYASSI DLHAGRIDPA KYKALVFSGH DEYWTPQMRA VLQGALSRGV SAAFMAANNV       360
     YWNIRLDASQ GGSQYRQVTC YKRRPDPAAT GSVAPTVLWR DLNQPEQQVL GSMYTAIITD       420
     TQPQPLVVGE TGHWFWAGTG LKNGEQIPRL VAGEADKVFP HVKGGPKTTV LATSPFTAEG       480
     PKNTPVKDTQ QTVLSQYPSG AWMFNAGTFH WNHGLSTPGF VDVRIQRATR NLLDRMTGKR       540
     SA                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page