(data stored in ACNUC7421 zone)

EMBL: CP001700.PE332

CP001700.PE332       Location/Qualifiers
FT   CDS             complement(374094..374549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0334"
FT                   /product="ribosomal protein L9"
FT                   /note="TIGRFAM: ribosomal protein L9; PFAM: ribosomal
FT                   protein L9; KEGG: sma:SAV_4286 50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69287"
FT                   /db_xref="GOA:C7PVD1"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD1"
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /protein_id="ACU69287.1"
FT                   /translation="MATTKLILTHEVGGLGEPGDVVEVKGGYARNYLVPRGYAIAWTRG
FT                   GEKQIELIRKARKVRTVRDLAHATELKGELEGLRVRLATRAGESGRLFGGVTVADVADA
FT                   VKRAGGPDVDKRRIEIGNPIKTVGAHTVSVRLHPEVQAKVEITVVAA"
     MATTKLILTH EVGGLGEPGD VVEVKGGYAR NYLVPRGYAI AWTRGGEKQI ELIRKARKVR        60
     TVRDLAHATE LKGELEGLRV RLATRAGESG RLFGGVTVAD VADAVKRAGG PDVDKRRIEI       120
     GNPIKTVGAH TVSVRLHPEV QAKVEITVVA A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page