(data stored in ACNUC7421 zone)

EMBL: CP001700.PE334

CP001700.PE334       Location/Qualifiers
FT   CDS             complement(374899..375558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0336"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: sgr:SGR_3673 putative single-strand DNA-
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69289"
FT                   /db_xref="GOA:C7PVD3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD3"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACU69289.1"
FT                   /translation="MAGETVITVVGNLTDDPELRFTPSGAAVANFTVASTPRTLDRQTN
FT                   EWKDGDALFLRCSIWRQAAENVAESLTRGMRVIVSGRLRQRSYETKEGEKRTVVELDVE
FT                   EIGPSLKYATAKVTKANRPGGQGGPGGGGGGGWSGNSGGGGNSGSAGGGGGWGGNSGGG
FT                   GNSGGGGGGGGSWGGNSGGGGGNSGGGNQGGGNDPWASGGGGDGGWGGYGNDEPPF"
     MAGETVITVV GNLTDDPELR FTPSGAAVAN FTVASTPRTL DRQTNEWKDG DALFLRCSIW        60
     RQAAENVAES LTRGMRVIVS GRLRQRSYET KEGEKRTVVE LDVEEIGPSL KYATAKVTKA       120
     NRPGGQGGPG GGGGGGWSGN SGGGGNSGSA GGGGGWGGNS GGGGNSGGGG GGGGSWGGNS       180
     GGGGGNSGGG NQGGGNDPWA SGGGGDGGWG GYGNDEPPF                              219
//

If you have problems or comments...

PBIL Back to PBIL home page