(data stored in ACNUC7421 zone)

EMBL: CP001700.PE335

CP001700.PE335       Location/Qualifiers
FT   CDS             complement(375589..375894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0337"
FT                   /product="ribosomal protein S6"
FT                   /note="TIGRFAM: ribosomal protein S6; PFAM: ribosomal
FT                   protein S6; KEGG: sco:SCO3906 30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69290"
FT                   /db_xref="GOA:C7PVD4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD4"
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /protein_id="ACU69290.1"
FT                   /translation="MRQYEVMVILDPDLDERSIAPALEGFLKVIRDLGGSIEKNDIWGR
FT                   RRLAYEIKTKSGKKVSEGIYAVVDVQATPDAVKEFDRQANLSETVVRTKVIRPDQR"
     MRQYEVMVIL DPDLDERSIA PALEGFLKVI RDLGGSIEKN DIWGRRRLAY EIKTKSGKKV        60
     SEGIYAVVDV QATPDAVKEF DRQANLSETV VRTKVIRPDQ R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page