(data stored in ACNUC7421 zone)

EMBL: CP001700.PE336

CP001700.PE336       Location/Qualifiers
FT   CDS             376147..376506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69291"
FT                   /db_xref="GOA:C7PVD5"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD5"
FT                   /inference="similar to AA sequence:KEGG:SAV_4290"
FT                   /protein_id="ACU69291.1"
FT                   /translation="MTQTTPGTGDYGPEVAGRPGSTAADYAEDPKERPGFHIGSHTQEM
FT                   ALTITALVLAVVAAAMIGWTGGHVLGGWIALAGIVVGLYAQLTSDTTYERMVNVCAIGI
FT                   AAVAFAFHLHHGGLW"
     MTQTTPGTGD YGPEVAGRPG STAADYAEDP KERPGFHIGS HTQEMALTIT ALVLAVVAAA        60
     MIGWTGGHVL GGWIALAGIV VGLYAQLTSD TTYERMVNVC AIGIAAVAFA FHLHHGGLW        119
//

If you have problems or comments...

PBIL Back to PBIL home page