(data stored in ACNUC7421 zone)

EMBL: CP001700.PE337

CP001700.PE337       Location/Qualifiers
FT   CDS             376634..377422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0339"
FT                   /product="apurinic endonuclease Apn1"
FT                   /note="KEGG: nca:Noca_4666 endonuclease IV; TIGRFAM:
FT                   apurinic endonuclease Apn1; PFAM: Xylose isomerase domain
FT                   protein TIM barrel; SMART: AP endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69292"
FT                   /db_xref="GOA:C7PVD6"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD6"
FT                   /inference="protein motif:TFAM:TIGR00587"
FT                   /protein_id="ACU69292.1"
FT                   /translation="MAMRIGSHVGNEDPIAEAVARGADAVQIFLGDPQSWKAPTVAYPG
FT                   GASALRAAAEQADVAVYVHAAYIINVAATNNRIRIPSRKLLQQTVALAAEAGARGVVVH
FT                   GGHSTAADAPDAGFDNWRKAVDQLEQHCPVFIENTAGGDHAMARRIDAIAKLWDAVGHS
FT                   GIGLCLDTCHAFAGGIPLESAVADIKAVTGRVDLVHANDSQGGFDSGIDRHANFGSGEI
FT                   APADLIAQVIAEAGCPAICETPGGAEAQAADIKWLRERVA"
     MAMRIGSHVG NEDPIAEAVA RGADAVQIFL GDPQSWKAPT VAYPGGASAL RAAAEQADVA        60
     VYVHAAYIIN VAATNNRIRI PSRKLLQQTV ALAAEAGARG VVVHGGHSTA ADAPDAGFDN       120
     WRKAVDQLEQ HCPVFIENTA GGDHAMARRI DAIAKLWDAV GHSGIGLCLD TCHAFAGGIP       180
     LESAVADIKA VTGRVDLVHA NDSQGGFDSG IDRHANFGSG EIAPADLIAQ VIAEAGCPAI       240
     CETPGGAEAQ AADIKWLRER VA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page