(data stored in ACNUC7421 zone)

EMBL: CP001700.PE338

CP001700.PE338       Location/Qualifiers
FT   CDS             377432..378616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0340"
FT                   /product="Methicillin resistance protein"
FT                   /note="PFAM: Methicillin resistance protein; KEGG:
FT                   sma:SAV_4291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69293"
FT                   /db_xref="GOA:C7PVD7"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD7"
FT                   /inference="protein motif:PFAM:PF02388"
FT                   /protein_id="ACU69293.1"
FT                   /translation="MVLRVRTLSREEHVAFIEERTAEKNAATSVSFLQCPSWGDLKTDW
FT                   RAESVGWVEDASGEVVGAALVLYRDVPIPKRDKLPFLRRSLAYLPEGPILDLTSADAGQ
FT                   ALKLLVAHLRKRRAFTVKMGPQMVSRRWTSETLKKAIAETEGGVRLKDIKPDFEDPTAL
FT                   SIIEKLRATGWSRKESEGAGFGDFQPRYVFQLPLVDESGKPRTLEDIQKGFNQLWRRNI
FT                   KKADKNGVEVTLGGYDDLAEFHKIYEVTAVRDHFTPRPLAYFQRMWKAMEAENPNRLRL
FT                   YLARHEGELLAATTLVTVGDHAWYSYGASADHKRELRPSNAIQWRMLSDSHASGCKVYD
FT                   LRGISDTLDPNDHLFGLIQFKLGTGGQAVEYLGEWDYALNPVLHRAFEMYMARR"
     MVLRVRTLSR EEHVAFIEER TAEKNAATSV SFLQCPSWGD LKTDWRAESV GWVEDASGEV        60
     VGAALVLYRD VPIPKRDKLP FLRRSLAYLP EGPILDLTSA DAGQALKLLV AHLRKRRAFT       120
     VKMGPQMVSR RWTSETLKKA IAETEGGVRL KDIKPDFEDP TALSIIEKLR ATGWSRKESE       180
     GAGFGDFQPR YVFQLPLVDE SGKPRTLEDI QKGFNQLWRR NIKKADKNGV EVTLGGYDDL       240
     AEFHKIYEVT AVRDHFTPRP LAYFQRMWKA MEAENPNRLR LYLARHEGEL LAATTLVTVG       300
     DHAWYSYGAS ADHKRELRPS NAIQWRMLSD SHASGCKVYD LRGISDTLDP NDHLFGLIQF       360
     KLGTGGQAVE YLGEWDYALN PVLHRAFEMY MARR                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page