(data stored in ACNUC7421 zone)

EMBL: CP001700.PE339

CP001700.PE339       Location/Qualifiers
FT   CDS             378675..379733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0341"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   sco:SCO3903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69294"
FT                   /db_xref="GOA:C7PVD8"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD8"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACU69294.1"
FT                   /translation="MSLTLHIDAERWRAHQDEVLARHPDLVPVAKGVNGYGIGIPNLMQ
FT                   AASKLAAAGVEITAVGTAAEAEQAKDHYSGRLLVLTPYLIGEDVRDLPDRVIRTVASVE
FT                   AVEALLGRRVVIDLMTSMRRFGLEKQDIPRLHAALESDQARVEGFSVHMPLDRVAGDYL
FT                   REVSDWVDALVAAGIPVRTLFVSHLSPDEISTLAKRHQGTTVRPRIGTQLWLGDRKALQ
FT                   ARGTVHSVQKVSKGDRFGYRQHKARGDGHLLVVSGGTAHGVGLENPKNFGRGPAGLTPR
FT                   AKFAARAAMALLNRTMSPYSWQGKTLWFAEPPHMQVSVLFLPAGVAPPKVGEEIPVEVS
FT                   PVMTHVDRVVFD"
     MSLTLHIDAE RWRAHQDEVL ARHPDLVPVA KGVNGYGIGI PNLMQAASKL AAAGVEITAV        60
     GTAAEAEQAK DHYSGRLLVL TPYLIGEDVR DLPDRVIRTV ASVEAVEALL GRRVVIDLMT       120
     SMRRFGLEKQ DIPRLHAALE SDQARVEGFS VHMPLDRVAG DYLREVSDWV DALVAAGIPV       180
     RTLFVSHLSP DEISTLAKRH QGTTVRPRIG TQLWLGDRKA LQARGTVHSV QKVSKGDRFG       240
     YRQHKARGDG HLLVVSGGTA HGVGLENPKN FGRGPAGLTP RAKFAARAAM ALLNRTMSPY       300
     SWQGKTLWFA EPPHMQVSVL FLPAGVAPPK VGEEIPVEVS PVMTHVDRVV FD               352
//

If you have problems or comments...

PBIL Back to PBIL home page