(data stored in ACNUC7421 zone)

EMBL: CP001700.PE34

CP001700.PE34        Location/Qualifiers
FT   CDS             34163..34690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0034"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: sgr:SGR_3729
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68989"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ0"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU68989.1"
FT                   /translation="MSQLTLTVIRLAFLVLLWLFVFSAVGVMRSDLYGSRTSKRQQAKA
FT                   AKAAAAATQQVPARGGARQQPYNPGARRSGPPAPTRLVVVGGSLAGTTVNITSGQQVTM
FT                   GRAHDSTIVLDDDYASSRHARLYPDASGQWIVEDLGSTNGTFLGQTKLNAPTVAQIGVP
FT                   IRIGKTVLELRA"
     MSQLTLTVIR LAFLVLLWLF VFSAVGVMRS DLYGSRTSKR QQAKAAKAAA AATQQVPARG        60
     GARQQPYNPG ARRSGPPAPT RLVVVGGSLA GTTVNITSGQ QVTMGRAHDS TIVLDDDYAS       120
     SRHARLYPDA SGQWIVEDLG STNGTFLGQT KLNAPTVAQI GVPIRIGKTV LELRA            175
//

If you have problems or comments...

PBIL Back to PBIL home page