(data stored in ACNUC7421 zone)

EMBL: CP001700.PE340

CP001700.PE340       Location/Qualifiers
FT   CDS             complement(380045..381613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69295"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD9"
FT                   /inference="similar to AA sequence:KEGG:SAV_4147"
FT                   /protein_id="ACU69295.1"
FT                   /translation="MSSTSKFLRDLAKKTNTASAARAVLRATHLKSGPGRLSDPRVGLP
FT                   ASVLPAGGNRITAENAKAGSADWRMGASKSRPGTDYERQIKGYASTDSVAAGEAIDFHI
FT                   AVEPAGSFTVSVYRLGYYGGASARRVLVSPTLTAAPQPVPTPDQETGRIALEWPVAWTL
FT                   DIPKDWTPGTYVAVLDKADGFRNYVPFVVRDDEASADFLVVLPSTSWQAYNWWPRDGIT
FT                   GRNVYYGYVTKEAAESDAALKAKFSTDARGWISNPARATQVSFARPYFADGLPDGFVRE
FT                   QSFIQWAEGMGYDLSYATGLDLHAGRIDPTKYRGLIFAGHDEYWSTDMYRHAEEAVAAG
FT                   TSLAFLTANNAYWHVRYDEHTRTMSCYKGFEDPHTEDFPTGMWRAGEGNPRAEQQLMGV
FT                   QYSGILKGRHPLIVHEADHWFWSGTGLTNGDEIPGLLGGEADSLFEAMPRAKAEEQALL
FT                   TASPYTISNGTNFTQNTSIYRSPSGAWVFTAGTFLWPLGLGHPTYQDKRITRATANFLS
FT                   RVKGS"
     MSSTSKFLRD LAKKTNTASA ARAVLRATHL KSGPGRLSDP RVGLPASVLP AGGNRITAEN        60
     AKAGSADWRM GASKSRPGTD YERQIKGYAS TDSVAAGEAI DFHIAVEPAG SFTVSVYRLG       120
     YYGGASARRV LVSPTLTAAP QPVPTPDQET GRIALEWPVA WTLDIPKDWT PGTYVAVLDK       180
     ADGFRNYVPF VVRDDEASAD FLVVLPSTSW QAYNWWPRDG ITGRNVYYGY VTKEAAESDA       240
     ALKAKFSTDA RGWISNPARA TQVSFARPYF ADGLPDGFVR EQSFIQWAEG MGYDLSYATG       300
     LDLHAGRIDP TKYRGLIFAG HDEYWSTDMY RHAEEAVAAG TSLAFLTANN AYWHVRYDEH       360
     TRTMSCYKGF EDPHTEDFPT GMWRAGEGNP RAEQQLMGVQ YSGILKGRHP LIVHEADHWF       420
     WSGTGLTNGD EIPGLLGGEA DSLFEAMPRA KAEEQALLTA SPYTISNGTN FTQNTSIYRS       480
     PSGAWVFTAG TFLWPLGLGH PTYQDKRITR ATANFLSRVK GS                          522
//

If you have problems or comments...

PBIL Back to PBIL home page