(data stored in ACNUC7421 zone)

EMBL: CP001700.PE341

CP001700.PE341       Location/Qualifiers
FT   CDS             complement(381644..382711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69296"
FT                   /db_xref="GOA:C7PVE0"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE0"
FT                   /inference="similar to AA sequence:KEGG:SGR_3221"
FT                   /protein_id="ACU69296.1"
FT                   /translation="MAVLTWISAWVFVAGPTKQGSLLARWDRWDEGIFTSVAQHWYFAA
FT                   GTDPRHVAFFPGFPIAMWLAHLVVWNWIAAGLVVSAAAGAIATMALGRLARDEVDASNA
FT                   DADAGQAAANATLFFVLAPAAVFLAAGYSESLFAAFAFSAWVAARRDRWWLAGLLAAGA
FT                   STVRVNGLFLAAAIALEFILAGRERRQWRQAPLLVIPALPVIAYVVYLHHETGDWLAWQ
FT                   HAQAAGWFRTFQSPESAWNQTWRAAFGGTQAGHTAWVFQLELIAVVIGLALTALLLLKR
FT                   RWPEALYVALSLLALGTTTWFMSVPRAMLLWWPLWTMLGAWAARRPMVRTLYVCCVAPV
FT                   MVGVALLFLSGQWAG"
     MAVLTWISAW VFVAGPTKQG SLLARWDRWD EGIFTSVAQH WYFAAGTDPR HVAFFPGFPI        60
     AMWLAHLVVW NWIAAGLVVS AAAGAIATMA LGRLARDEVD ASNADADAGQ AAANATLFFV       120
     LAPAAVFLAA GYSESLFAAF AFSAWVAARR DRWWLAGLLA AGASTVRVNG LFLAAAIALE       180
     FILAGRERRQ WRQAPLLVIP ALPVIAYVVY LHHETGDWLA WQHAQAAGWF RTFQSPESAW       240
     NQTWRAAFGG TQAGHTAWVF QLELIAVVIG LALTALLLLK RRWPEALYVA LSLLALGTTT       300
     WFMSVPRAML LWWPLWTMLG AWAARRPMVR TLYVCCVAPV MVGVALLFLS GQWAG            355
//

If you have problems or comments...

PBIL Back to PBIL home page