(data stored in ACNUC7421 zone)

EMBL: CP001700.PE342

CP001700.PE342       Location/Qualifiers
FT   CDS             complement(382884..384455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0344"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO3902 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69297"
FT                   /db_xref="GOA:C7PVE1"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE1"
FT                   /inference="similar to AA sequence:KEGG:SCO3902"
FT                   /protein_id="ACU69297.1"
FT                   /translation="MQTGDGAVGHDVQVSSDVSDQAPGPSAEPTGRGAATAPVIVAPSL
FT                   DDPVVNAASDAVGGPLGVRAWRPRLGSGAAIRTVARVLVLLTLLTLGIGVAQRSPCYST
FT                   AWNGTGKQQYNHLCYTDVPYMYYGRGFDKSLTPYRQSDPASGNYGLEYPVVAGATMETA
FT                   ALLAQKLGADTPDQVRWFYNVTTWFLIVFALVCVLAVIGLAGRRPWDAAMFALAPGLLL
FT                   TGTINWDLIAVALASVGMLAWARNKPVVAGIALGLGSATKLYPVFLLIPLLVLCWRAGR
FT                   MRQWSQATGTAVVTWLVVNAPVMILAFKGWKYFFTFNDNRPIDLGSPWFAIRHWWGWEP
FT                   PNKNVVIIALVLAGWLGVALLGLMARRRPRFAQLAFLTVAVFILLNKVYSPQYVLWLIP
FT                   LAALARPRWRDFLIWQICEAAYYVAVWYYLVWQAGPSNGNTRGLPDNFYVWAIVIHLAG
FT                   IVYMMVQIIRDILDPRRDPVRADGIDDDPAGGALSDSPDVWAWSQPRSHRAGHGAGAEP
FT                   ELVASV"
     MQTGDGAVGH DVQVSSDVSD QAPGPSAEPT GRGAATAPVI VAPSLDDPVV NAASDAVGGP        60
     LGVRAWRPRL GSGAAIRTVA RVLVLLTLLT LGIGVAQRSP CYSTAWNGTG KQQYNHLCYT       120
     DVPYMYYGRG FDKSLTPYRQ SDPASGNYGL EYPVVAGATM ETAALLAQKL GADTPDQVRW       180
     FYNVTTWFLI VFALVCVLAV IGLAGRRPWD AAMFALAPGL LLTGTINWDL IAVALASVGM       240
     LAWARNKPVV AGIALGLGSA TKLYPVFLLI PLLVLCWRAG RMRQWSQATG TAVVTWLVVN       300
     APVMILAFKG WKYFFTFNDN RPIDLGSPWF AIRHWWGWEP PNKNVVIIAL VLAGWLGVAL       360
     LGLMARRRPR FAQLAFLTVA VFILLNKVYS PQYVLWLIPL AALARPRWRD FLIWQICEAA       420
     YYVAVWYYLV WQAGPSNGNT RGLPDNFYVW AIVIHLAGIV YMMVQIIRDI LDPRRDPVRA       480
     DGIDDDPAGG ALSDSPDVWA WSQPRSHRAG HGAGAEPELV ASV                         523
//

If you have problems or comments...

PBIL Back to PBIL home page