(data stored in ACNUC7421 zone)

EMBL: CP001700.PE343

CP001700.PE343       Location/Qualifiers
FT   CDS             complement(384476..387439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0345"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; penicillin-
FT                   binding protein transpeptidase; KEGG: sma:SAV_4294
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69298"
FT                   /db_xref="GOA:C7PVE2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE2"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ACU69298.1"
FT                   /translation="MSEHGSRRGGGGGGGSRGRRSAGGGGFSDKLDGLAHQLSGMFGKR
FT                   GAGRRGDDGYDEYGSYDDRGYGEEPYDDGYGAEPADVAVGGRRGLGRRTAAGSGGAGRG
FT                   GRPGGSGRKDGLPPKDWWMKFINYPRYGKRGWRHWMPSIKQVLSIFLGFLFVVIGGVAY
FT                   VYASTQIPQVKNSIAAGNPTYYTYDDGKEQFANIGVNYYQVNDINTIPKVFQNAFVAAE
FT                   NYSFWSDPGVSFTGVARSALNDLFGSGGTQGGSTITQQYVKNAYLSQDQTLGRKVNEIM
FT                   ISIKLNHTESKQQILLGYLNQISFGRGAYGIDAASRAYFGHPINQMTDANVGEAAFLAA
FT                   LVNDPSNFSTALANGKARTDNPKTFDRFEKRYNAILANMSQYGFVPKTTTAPLENKLPN
FT                   VIDFKGPNLGQYVGYMKDAATAFLAAQMQEYPSDPTTQKYANIDNLSKGGYKIVTTYNH
FT                   VMMNDSVTAANALWTGTSGGGGGKLNPKHASDHDIHLAFASVDPHTGELKSFYTGTDGK
FT                   EDYGSNAFNYALQGGVQVGSTFKPITLATALQSGKFSLDSQEPGTNEKPLFLPGSKQPI
FT                   TFYDTSLHKTAFWPPNEDEEAPPNGGSTTLKQGLAMSLNSVFAALELDPAVGMDAVYNM
FT                   AEQLGIKPGTPDFLKVASLTLGTAEITPMRMANVYGAFANGGVSHEPVQVTAIIDQRTG
FT                   QTVWTPPALRSNSGVNKQVMSVNTAAGVTNALQSVLQKGGTANANHDAAALAAEANYNL
FT                   AGKTGTTDSNHSAWFTGFSTSLATSVAIFRSTADGTLESIKGLGYNDQSTRINGMDWPT
FT                   TVWSAFMKIELDKNKSGFAKPFPPYAPTCSGVSDIPSFPNQSVAPGTLASGSLPGTPTG
FT                   SEANCQSVFVPTPTPTPTPTPTKPTTSTQAPLCTLPMVFDPASQQCVVVPPTSTDTSTQ
FT                   QQPTGTGTSNPTGPGQPTTSPTTPSSRCSRNPQQPGCQTTSPTTSSTSSLSGFPPAG"
     MSEHGSRRGG GGGGGSRGRR SAGGGGFSDK LDGLAHQLSG MFGKRGAGRR GDDGYDEYGS        60
     YDDRGYGEEP YDDGYGAEPA DVAVGGRRGL GRRTAAGSGG AGRGGRPGGS GRKDGLPPKD       120
     WWMKFINYPR YGKRGWRHWM PSIKQVLSIF LGFLFVVIGG VAYVYASTQI PQVKNSIAAG       180
     NPTYYTYDDG KEQFANIGVN YYQVNDINTI PKVFQNAFVA AENYSFWSDP GVSFTGVARS       240
     ALNDLFGSGG TQGGSTITQQ YVKNAYLSQD QTLGRKVNEI MISIKLNHTE SKQQILLGYL       300
     NQISFGRGAY GIDAASRAYF GHPINQMTDA NVGEAAFLAA LVNDPSNFST ALANGKARTD       360
     NPKTFDRFEK RYNAILANMS QYGFVPKTTT APLENKLPNV IDFKGPNLGQ YVGYMKDAAT       420
     AFLAAQMQEY PSDPTTQKYA NIDNLSKGGY KIVTTYNHVM MNDSVTAANA LWTGTSGGGG       480
     GKLNPKHASD HDIHLAFASV DPHTGELKSF YTGTDGKEDY GSNAFNYALQ GGVQVGSTFK       540
     PITLATALQS GKFSLDSQEP GTNEKPLFLP GSKQPITFYD TSLHKTAFWP PNEDEEAPPN       600
     GGSTTLKQGL AMSLNSVFAA LELDPAVGMD AVYNMAEQLG IKPGTPDFLK VASLTLGTAE       660
     ITPMRMANVY GAFANGGVSH EPVQVTAIID QRTGQTVWTP PALRSNSGVN KQVMSVNTAA       720
     GVTNALQSVL QKGGTANANH DAAALAAEAN YNLAGKTGTT DSNHSAWFTG FSTSLATSVA       780
     IFRSTADGTL ESIKGLGYND QSTRINGMDW PTTVWSAFMK IELDKNKSGF AKPFPPYAPT       840
     CSGVSDIPSF PNQSVAPGTL ASGSLPGTPT GSEANCQSVF VPTPTPTPTP TPTKPTTSTQ       900
     APLCTLPMVF DPASQQCVVV PPTSTDTSTQ QQPTGTGTSN PTGPGQPTTS PTTPSSRCSR       960
     NPQQPGCQTT SPTTSSTSSL SGFPPAG                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page