(data stored in ACNUC7421 zone)

EMBL: CP001700.PE344

CP001700.PE344       Location/Qualifiers
FT   CDS             387837..388442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0346"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: sco:SCO3900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69299"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE3"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ACU69299.1"
FT                   /translation="MAKRSQILELAVLGLLHEHPMHGYELRRQLNVQLGAFRALSYGTL
FT                   YPCLKDLVARGWIAEDDTQTANVAASRRAKISYKLTAEGKERFQELMTTSGSAAWEDDN
FT                   FGVHFAFFGRTNAGVRIRILEGRRSRLEERMEAVRTSLARSRDRLDSYTLELQRHGLES
FT                   TEREVRWLNELIRTEHEQAFPAPPQQQPQQGSPEPRPS"
     MAKRSQILEL AVLGLLHEHP MHGYELRRQL NVQLGAFRAL SYGTLYPCLK DLVARGWIAE        60
     DDTQTANVAA SRRAKISYKL TAEGKERFQE LMTTSGSAAW EDDNFGVHFA FFGRTNAGVR       120
     IRILEGRRSR LEERMEAVRT SLARSRDRLD SYTLELQRHG LESTEREVRW LNELIRTEHE       180
     QAFPAPPQQQ PQQGSPEPRP S                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page