(data stored in ACNUC7421 zone)

EMBL: CP001700.PE345

CP001700.PE345       Location/Qualifiers
FT   CDS             388574..389653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0347"
FT                   /product="inositol 1-phosphate synthase"
FT                   /note="TIGRFAM: inositol 1-phosphate synthase; PFAM:
FT                   Myo-inositol-1-phosphate synthase; Myo-
FT                   inositol-1-phosphate synthase GAPDH domain protein; KEGG:
FT                   sco:SCO3899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69300"
FT                   /db_xref="GOA:C7PVE4"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE4"
FT                   /inference="protein motif:TFAM:TIGR03450"
FT                   /protein_id="ACU69300.1"
FT                   /translation="MGSVRVAIIGVGNCAASLVQGVEYYKDADPNAKVPGLMHVQFGDY
FT                   HVSDLEFVAAFDVDAKKVGLDLADAIGASENNTIKIADVPPTGVVVQRGHTNDGLGKYY
FT                   RQTIVESDAEPVDMVAALKAAKADVVVCYLPVGSQSAVEYYAQVAIDAKVAFVNALPVF
FT                   IAGTKAWADKFEAAGVPIVGDDIKSQVGATITHRVLAKLFEDRGVVLDRTMQLNVGGNM
FT                   DFMNMLERERLESKKISKTQAVTSQLSHDLGAGNVHIGPSDYVAWLDDRKWAYVRLEGR
FT                   AFGDVPLNLEYKLEVWDSPNSAGVIIDAVRCAKIALDRGIGGPILSASSYFMKSPPVQY
FT                   FDDEARDAVEAFIKGEVER"
     MGSVRVAIIG VGNCAASLVQ GVEYYKDADP NAKVPGLMHV QFGDYHVSDL EFVAAFDVDA        60
     KKVGLDLADA IGASENNTIK IADVPPTGVV VQRGHTNDGL GKYYRQTIVE SDAEPVDMVA       120
     ALKAAKADVV VCYLPVGSQS AVEYYAQVAI DAKVAFVNAL PVFIAGTKAW ADKFEAAGVP       180
     IVGDDIKSQV GATITHRVLA KLFEDRGVVL DRTMQLNVGG NMDFMNMLER ERLESKKISK       240
     TQAVTSQLSH DLGAGNVHIG PSDYVAWLDD RKWAYVRLEG RAFGDVPLNL EYKLEVWDSP       300
     NSAGVIIDAV RCAKIALDRG IGGPILSASS YFMKSPPVQY FDDEARDAVE AFIKGEVER        359
//

If you have problems or comments...

PBIL Back to PBIL home page