(data stored in ACNUC7421 zone)

EMBL: CP001700.PE346

CP001700.PE346       Location/Qualifiers
FT   CDS             389821..392364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0348"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; KEGG: ace:Acel_1461 cell wall binding
FT                   repeat 2- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69301"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE5"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69301.1"
FT                   /translation="MGRKREISVISSLVVAGAAFGGSVVSAPTASAASITVSASGADVV
FT                   AINPAMFGGGAPTDQVSTQLAQILRNSARYLGTTWYNQTYGNSLASDGYLNLDIPGAVP
FT                   EQSFRLPGMAAVSIATAVKLGDWDAGASGISADEAENRAATMVRALAHRYYANNSLAGV
FT                   STWGNSWQSPLWAFYTGQAAWLVWDKLSPSERNDVARMMADEANRLLTGNDVYLTSDTG
FT                   SQQLYQYNRGGTDVTPGDTKAEEDNYEAQLLGLAVAMMPNHPNAARWQRRNEDLLIADT
FT                   ATPDDLTNSAAGNAVVNGRQLNQWLQGYNMQADGTVQNHDILHPLYMTALDQSLQQVGT
FT                   FALAGQCAPQAATNNVGLTYKALTTQTSFPYAPDPNNLTQDVTAKTPDGKPIYESTSSP
FT                   QINYPQGNDWGTQFPAYYGSFDALVSAYSPYLVGENNQAPTATANAVTHLQSEISLQSR
FT                   FGDGQTYQPWNPATTPGDKAENSYVGAEQRVGQITAQAYMAEFLNHHSRGCFTNSGNPT
FT                   PPNVPPVQPTAVSRLSGTDRYGTGVAVSQAQWSNAGGDNTPRAIADAVVLARGDNFPDA
FT                   LAGTPLAKRDRGPLLLTEPGALNPVTANEIKRVLPKGKTVYILGGNQAVSPKVQSQLVA
FT                   LGYTVKRFGGSDRYQTALLIAQQGMGSPHQVVVATGQDFADALAAGPLAADEGNAILLS
FT                   NGKTLDANTKAYIAGAQRKNGAADPAFHLNAVGGAAVAATHYLGSQSHALMGNDRYQTA
FT                   AAVAARFAADMPVTQFGVATGTQFADALTGGAFMANANEPLLLTAPTALAPSDTTLLHG
FT                   MRSQLSAVTLFGGPVALKQAVMDQIAHAVGGVERR"
     MGRKREISVI SSLVVAGAAF GGSVVSAPTA SAASITVSAS GADVVAINPA MFGGGAPTDQ        60
     VSTQLAQILR NSARYLGTTW YNQTYGNSLA SDGYLNLDIP GAVPEQSFRL PGMAAVSIAT       120
     AVKLGDWDAG ASGISADEAE NRAATMVRAL AHRYYANNSL AGVSTWGNSW QSPLWAFYTG       180
     QAAWLVWDKL SPSERNDVAR MMADEANRLL TGNDVYLTSD TGSQQLYQYN RGGTDVTPGD       240
     TKAEEDNYEA QLLGLAVAMM PNHPNAARWQ RRNEDLLIAD TATPDDLTNS AAGNAVVNGR       300
     QLNQWLQGYN MQADGTVQNH DILHPLYMTA LDQSLQQVGT FALAGQCAPQ AATNNVGLTY       360
     KALTTQTSFP YAPDPNNLTQ DVTAKTPDGK PIYESTSSPQ INYPQGNDWG TQFPAYYGSF       420
     DALVSAYSPY LVGENNQAPT ATANAVTHLQ SEISLQSRFG DGQTYQPWNP ATTPGDKAEN       480
     SYVGAEQRVG QITAQAYMAE FLNHHSRGCF TNSGNPTPPN VPPVQPTAVS RLSGTDRYGT       540
     GVAVSQAQWS NAGGDNTPRA IADAVVLARG DNFPDALAGT PLAKRDRGPL LLTEPGALNP       600
     VTANEIKRVL PKGKTVYILG GNQAVSPKVQ SQLVALGYTV KRFGGSDRYQ TALLIAQQGM       660
     GSPHQVVVAT GQDFADALAA GPLAADEGNA ILLSNGKTLD ANTKAYIAGA QRKNGAADPA       720
     FHLNAVGGAA VAATHYLGSQ SHALMGNDRY QTAAAVAARF AADMPVTQFG VATGTQFADA       780
     LTGGAFMANA NEPLLLTAPT ALAPSDTTLL HGMRSQLSAV TLFGGPVALK QAVMDQIAHA       840
     VGGVERR                                                                 847
//

If you have problems or comments...

PBIL Back to PBIL home page