(data stored in ACNUC7421 zone)

EMBL: CP001700.PE347

CP001700.PE347       Location/Qualifiers
FT   CDS             392494..393327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0349"
FT                   /product="protein of unknown function DUF1684"
FT                   /note="PFAM: protein of unknown function DUF1684; KEGG:
FT                   sco:SCO1747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69302"
FT                   /db_xref="InterPro:IPR012467"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE6"
FT                   /inference="protein motif:PFAM:PF07920"
FT                   /protein_id="ACU69302.1"
FT                   /translation="MSETEQTATIPAAPADWYQWAEKREASVSGEYGVLALVGTHWLDE
FT                   GPAVSIDGLPGLWAAAGHRVSVTALPADALLVDGVPVDGVRFLDPDLALDPSVLFHHGR
FT                   KLVPIIREGVLALRVYDPEAENRRSFAGISRFPYDPALVFTARYERYVHGHVERVLNAD
FT                   GKERGLALNGDLVFEHGGAEYRLAVTANGGEDFDVTFGDATNGPDTFGFRQLTVPAPHL
FT                   DDPDNPDSGTTVLDFNRAQLPPCAFSDHFICPVPPVGNRLELAVAAGEKRREVRT"
     MSETEQTATI PAAPADWYQW AEKREASVSG EYGVLALVGT HWLDEGPAVS IDGLPGLWAA        60
     AGHRVSVTAL PADALLVDGV PVDGVRFLDP DLALDPSVLF HHGRKLVPII REGVLALRVY       120
     DPEAENRRSF AGISRFPYDP ALVFTARYER YVHGHVERVL NADGKERGLA LNGDLVFEHG       180
     GAEYRLAVTA NGGEDFDVTF GDATNGPDTF GFRQLTVPAP HLDDPDNPDS GTTVLDFNRA       240
     QLPPCAFSDH FICPVPPVGN RLELAVAAGE KRREVRT                                277
//

If you have problems or comments...

PBIL Back to PBIL home page