(data stored in ACNUC7421 zone)

EMBL: CP001700.PE349

CP001700.PE349       Location/Qualifiers
FT   CDS             complement(393958..394182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69304"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69304.1"
FT                   /translation="MRKFATFAALALSAGTAVAGGACVANADVNLGVDAPTTSTAPAAG
FT                   SMDFAGTWCGAPWLWSGQQAGAGCNAQGH"
     MRKFATFAAL ALSAGTAVAG GACVANADVN LGVDAPTTST APAAGSMDFA GTWCGAPWLW        60
     SGQQAGAGCN AQGH                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page