(data stored in ACNUC7421 zone)

EMBL: CP001700.PE35

CP001700.PE35        Location/Qualifiers
FT   CDS             34710..36773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0035"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: sgr:SGR_3728 putative
FT                   protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68990"
FT                   /db_xref="GOA:C7QFQ1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ1"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ACU68990.1"
FT                   /translation="MALVLRYAIRSHVGLIREGNEDSGYAGPRLLAIADGMGGAAAGEL
FT                   ASAVVMTTVSRLDSPGGEDLLSGTGEMPVMAPGGAGPGQGQPAPGAPGGGPGGQGGPGG
FT                   VPENEQTLHISQHDMAARESGNAHSPADPAFGEPDLALLGGAVVAANERLRAIVAERPE
FT                   LEGMGTTLTAMLWSGGRFGMVHVGDSRAYRLRDGLLEQMTADHTWVQRLIDEGRITEEE
FT                   AGHHPQRSLLMRVLDGRTQVEADIGTFDAYPGDRYLLCSDGLSGFVSQETLAETLAAYA
FT                   DPQQAVDALIELALRAGGPDNITCIVADTLDDGTIPGASPNESTQMLGSLTPVVVGAAS
FT                   EGVEQLPRFSTQGSGGPGPGPQQDDFPQNHPAGRAARLRSRRNQNQNSQNQNAQNQQLA
FT                   AEQHPGGPVTTAQQQFDPSAQTTELDSVPGQRGLVPGAENQQPGSRRNADGGYGGAPDG
FT                   GPGGPGGPAPAKRGKKGLIITGAVVVVLAAAAGGAYVYSQGQYYVTPSTDSKQVLLYQG
FT                   LSQVSFASSQQTMSEGPLWIASVPQSKRADLFKTESFGSKGAALSYLEQYRSAAKSCAD
FT                   YRHNQLVVQSHPQQSAVTGKTAGTTVPGQNLAPSAPPTSSKAGAPLANGPANTVQNPTA
FT                   PTGDPAGTTAPTGGEQGSPEPQNPTSSPSAPASQPGDDPQMKAYCAGTTDGP"
     MALVLRYAIR SHVGLIREGN EDSGYAGPRL LAIADGMGGA AAGELASAVV MTTVSRLDSP        60
     GGEDLLSGTG EMPVMAPGGA GPGQGQPAPG APGGGPGGQG GPGGVPENEQ TLHISQHDMA       120
     ARESGNAHSP ADPAFGEPDL ALLGGAVVAA NERLRAIVAE RPELEGMGTT LTAMLWSGGR       180
     FGMVHVGDSR AYRLRDGLLE QMTADHTWVQ RLIDEGRITE EEAGHHPQRS LLMRVLDGRT       240
     QVEADIGTFD AYPGDRYLLC SDGLSGFVSQ ETLAETLAAY ADPQQAVDAL IELALRAGGP       300
     DNITCIVADT LDDGTIPGAS PNESTQMLGS LTPVVVGAAS EGVEQLPRFS TQGSGGPGPG       360
     PQQDDFPQNH PAGRAARLRS RRNQNQNSQN QNAQNQQLAA EQHPGGPVTT AQQQFDPSAQ       420
     TTELDSVPGQ RGLVPGAENQ QPGSRRNADG GYGGAPDGGP GGPGGPAPAK RGKKGLIITG       480
     AVVVVLAAAA GGAYVYSQGQ YYVTPSTDSK QVLLYQGLSQ VSFASSQQTM SEGPLWIASV       540
     PQSKRADLFK TESFGSKGAA LSYLEQYRSA AKSCADYRHN QLVVQSHPQQ SAVTGKTAGT       600
     TVPGQNLAPS APPTSSKAGA PLANGPANTV QNPTAPTGDP AGTTAPTGGE QGSPEPQNPT       660
     SSPSAPASQP GDDPQMKAYC AGTTDGP                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page