(data stored in ACNUC7421 zone)

EMBL: CP001700.PE350

CP001700.PE350       Location/Qualifiers
FT   CDS             complement(394286..397018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0352"
FT                   /product="Peptidase S53 propeptide"
FT                   /note="PFAM: Peptidase S53 propeptide; KEGG: sma:SAV_5949
FT                   serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69305"
FT                   /db_xref="GOA:C7PVE9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE9"
FT                   /inference="protein motif:PFAM:PF09286"
FT                   /protein_id="ACU69305.1"
FT                   /translation="MVGRFRHVTATLAVAALMAAPNAVSAATTSVTAADGPTTARIGLA
FT                   GADPDGLQQLARAVADPHSTQYRHFLTPAQLQAKYGPTPAQLKQVHQWLTTGGLTITGE
FT                   NAHWIDVAGSSAKVRKAFGHLPQLRIRQGIGAGYAARAAATVPPALAGAVSSVAGLMPE
FT                   RQGMRQFSYRVMTGARSRALTGGGVDPGGPMQPAQPAAPGGQGGQGGPLQPTQGTQVNP
FT                   GGPMQPAQPAAPGTQGGQNGPVQPTLGTQINPGGPMQPAQPAAPGTQGSQGGPVQPTSG
FT                   AQPAQPAAPGTQRASVQQAPRTQINPGGPMQPAQPAQPAAPGTQRASMQQAPRTQINPG
FT                   GLMRPATREMPAAQVDPGGPMQPSAPVMPAPKGPVGSGGAGGGVNPGGPMQPSGPAGSA
FT                   GPVGPIVVGGPIRRSLPGGAGGLVSPSVSSTACSADWGASPAVGVPEGYNKPDPLVACG
FT                   LTPKRLRAAYGVTAAGFSGRGAIIGIVDAYGSPTMRADADAFAKSVGDLAFGAGQYMES
FT                   VDRGAWKHLGDGVCETPAAWGGEEALDVEVAHGLAPGAVVHYFGAASCQDQDIAAMLAS
FT                   IVDKHLADEVTGSFGEIMHSAGGDIDPALVMQENQIFTTGAAEGIGFAFATGDCGDQAA
FT                   GLSGPGCDTGSARAQVEWPAASPWVTAVGGTALAVAPNGTRRWEAPMGDLRSDLSADGS
FT                   KWAPLPGQFFFGGGGGLSGDFDQPAYQKGVVPADLASPVVGGKATGKASGTASGKAAST
FT                   AVGPAKRTVPDVAMDGDLLTAVLTGHTDPTLGGYGQDVIGGTSAAAPMFAAVQADAMQA
FT                   AGGALGFANPALYKRSGTKQFTDIVAGPKGAPNPISAVVDHGTFGDVHEARLFKLGADH
FT                   GLSARKGYDTATGLGSPTAAYITSFKPAPSKTGTGKKKP"
     MVGRFRHVTA TLAVAALMAA PNAVSAATTS VTAADGPTTA RIGLAGADPD GLQQLARAVA        60
     DPHSTQYRHF LTPAQLQAKY GPTPAQLKQV HQWLTTGGLT ITGENAHWID VAGSSAKVRK       120
     AFGHLPQLRI RQGIGAGYAA RAAATVPPAL AGAVSSVAGL MPERQGMRQF SYRVMTGARS       180
     RALTGGGVDP GGPMQPAQPA APGGQGGQGG PLQPTQGTQV NPGGPMQPAQ PAAPGTQGGQ       240
     NGPVQPTLGT QINPGGPMQP AQPAAPGTQG SQGGPVQPTS GAQPAQPAAP GTQRASVQQA       300
     PRTQINPGGP MQPAQPAQPA APGTQRASMQ QAPRTQINPG GLMRPATREM PAAQVDPGGP       360
     MQPSAPVMPA PKGPVGSGGA GGGVNPGGPM QPSGPAGSAG PVGPIVVGGP IRRSLPGGAG       420
     GLVSPSVSST ACSADWGASP AVGVPEGYNK PDPLVACGLT PKRLRAAYGV TAAGFSGRGA       480
     IIGIVDAYGS PTMRADADAF AKSVGDLAFG AGQYMESVDR GAWKHLGDGV CETPAAWGGE       540
     EALDVEVAHG LAPGAVVHYF GAASCQDQDI AAMLASIVDK HLADEVTGSF GEIMHSAGGD       600
     IDPALVMQEN QIFTTGAAEG IGFAFATGDC GDQAAGLSGP GCDTGSARAQ VEWPAASPWV       660
     TAVGGTALAV APNGTRRWEA PMGDLRSDLS ADGSKWAPLP GQFFFGGGGG LSGDFDQPAY       720
     QKGVVPADLA SPVVGGKATG KASGTASGKA ASTAVGPAKR TVPDVAMDGD LLTAVLTGHT       780
     DPTLGGYGQD VIGGTSAAAP MFAAVQADAM QAAGGALGFA NPALYKRSGT KQFTDIVAGP       840
     KGAPNPISAV VDHGTFGDVH EARLFKLGAD HGLSARKGYD TATGLGSPTA AYITSFKPAP       900
     SKTGTGKKKP                                                              910
//

If you have problems or comments...

PBIL Back to PBIL home page