(data stored in ACNUC7421 zone)

EMBL: CP001700.PE351

CP001700.PE351       Location/Qualifiers
FT   CDS             complement(397134..398669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0353"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fre:Franean1_3555 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69306"
FT                   /db_xref="GOA:C7PVF0"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF0"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU69306.1"
FT                   /translation="MRKWLPLVAVCLGTFMLLVDVTIVTVALPDMARSLDTTFADLQWV
FT                   MDVYALVLAALLLAAGSLGDRAGHRRLYVAGLVVFAAASLACGLATSPGVLIAFRAVQG
FT                   VGGAAMLATTVALISHLYSGRDLGTAFGVWGAVSGAAAAAGPIMGGLLTQHLDWRWIFF
FT                   VNLPISVAAVAMTLRYVGESRGERRRGLDLPGLLTFTAAAGLATYALIKGNDYGWGSAR
FT                   TIGVFAGAAVALVAFVVAELRVRTPLLDLSLFRRGTFTGVMIGALLLSGAAFSYFAYES
FT                   LWLQSALGMSPVTAGLCFVPMSGAAFVTAGLGGRLLEDRLSPRVMIGGGLLLIAAGSAA
FT                   QMLVSAGSSWTVLVPGLVVSGVGVGLATPTLVSTAVAAVGYQRAGMASGAVNTARQLGN
FT                   ALGIAVLGVVFHAGLASSVRGAGVPQSAAVADALAAGQTRGVLASGPAAQRPALEHMVH
FT                   AAFASGLRSAFLAAAVMGAVGGLAVLALVRRPGGGHAPGEQSSAANVPIPAEA"
     MRKWLPLVAV CLGTFMLLVD VTIVTVALPD MARSLDTTFA DLQWVMDVYA LVLAALLLAA        60
     GSLGDRAGHR RLYVAGLVVF AAASLACGLA TSPGVLIAFR AVQGVGGAAM LATTVALISH       120
     LYSGRDLGTA FGVWGAVSGA AAAAGPIMGG LLTQHLDWRW IFFVNLPISV AAVAMTLRYV       180
     GESRGERRRG LDLPGLLTFT AAAGLATYAL IKGNDYGWGS ARTIGVFAGA AVALVAFVVA       240
     ELRVRTPLLD LSLFRRGTFT GVMIGALLLS GAAFSYFAYE SLWLQSALGM SPVTAGLCFV       300
     PMSGAAFVTA GLGGRLLEDR LSPRVMIGGG LLLIAAGSAA QMLVSAGSSW TVLVPGLVVS       360
     GVGVGLATPT LVSTAVAAVG YQRAGMASGA VNTARQLGNA LGIAVLGVVF HAGLASSVRG       420
     AGVPQSAAVA DALAAGQTRG VLASGPAAQR PALEHMVHAA FASGLRSAFL AAAVMGAVGG       480
     LAVLALVRRP GGGHAPGEQS SAANVPIPAE A                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page