(data stored in ACNUC7421 zone)

EMBL: CP001700.PE352

CP001700.PE352       Location/Qualifiers
FT   CDS             398804..399820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0354"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: sma:SAV_1846
FT                   transcription regulator AsnC"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69307"
FT                   /db_xref="GOA:C7PVF1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF1"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACU69307.1"
FT                   /translation="MSTDQRVEEFDRLDRQLAQALMIDGRASFSRLAEVLGVTDQTVTR
FT                   RYRRLRSGGLLRVIGLPLGNRVGLYQSNVRVQCVPGAAGAIADALARRRDIGWVTINAS
FT                   GTEVSCMTRSPSRRERDLLLLDKLPRTRQVTGVSVKTIMHAFVGGPGGWPGLAADLGAD
FT                   QAAALHRDFPEVPGEFELDDADHALLAVLARDGRAPYPELAAAVGKSESTVRRRVEHLM
FT                   DNGVLYFDVEVLPVHLGFHVEAMVSAAVAPSDLDAVGRAVGSHPEVPFAAATTGPTNLA
FT                   AVVVCREIQDLYEYVTGRMGAIKEIGQLEVVQVLRTVKRAGLLTDGVRLFDPPETVY"
     MSTDQRVEEF DRLDRQLAQA LMIDGRASFS RLAEVLGVTD QTVTRRYRRL RSGGLLRVIG        60
     LPLGNRVGLY QSNVRVQCVP GAAGAIADAL ARRRDIGWVT INASGTEVSC MTRSPSRRER       120
     DLLLLDKLPR TRQVTGVSVK TIMHAFVGGP GGWPGLAADL GADQAAALHR DFPEVPGEFE       180
     LDDADHALLA VLARDGRAPY PELAAAVGKS ESTVRRRVEH LMDNGVLYFD VEVLPVHLGF       240
     HVEAMVSAAV APSDLDAVGR AVGSHPEVPF AAATTGPTNL AAVVVCREIQ DLYEYVTGRM       300
     GAIKEIGQLE VVQVLRTVKR AGLLTDGVRL FDPPETVY                               338
//

If you have problems or comments...

PBIL Back to PBIL home page