(data stored in ACNUC7421 zone)

EMBL: CP001700.PE353

CP001700.PE353       Location/Qualifiers
FT   CDS             complement(399928..400599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO4536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69308"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69308.1"
FT                   /translation="MSTAAETAGSKPINYRLNLGEGWTRIRLDDHAEADVNAFLDTVFA
FT                   AVPADAAEAGRDLIGGRLTTQIVAGRAKGGIDFYIPTPGGGPVPALTVMASEVKIPSAA
FT                   VPEPADVVARVAASNPTARTGVIAGMPAVRIDRSAGAGLDAEPAGEDAEEDKDGFQPPR
FT                   PRHIEYVVPVAGDPDHRWLSIALTGQAGPGGDEAKVDAAISRFDQAVADLAWTEGEGSG
FT                   A"
     MSTAAETAGS KPINYRLNLG EGWTRIRLDD HAEADVNAFL DTVFAAVPAD AAEAGRDLIG        60
     GRLTTQIVAG RAKGGIDFYI PTPGGGPVPA LTVMASEVKI PSAAVPEPAD VVARVAASNP       120
     TARTGVIAGM PAVRIDRSAG AGLDAEPAGE DAEEDKDGFQ PPRPRHIEYV VPVAGDPDHR       180
     WLSIALTGQA GPGGDEAKVD AAISRFDQAV ADLAWTEGEG SGA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page