(data stored in ACNUC7421 zone)

EMBL: CP001700.PE354

CP001700.PE354       Location/Qualifiers
FT   CDS             400940..401581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69309"
FT                   /db_xref="GOA:C7PVF3"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69309.1"
FT                   /translation="MGAATALTLLGPAAASAAADTTPAPPAGVTVDVLGGSTPADEHAA
FT                   IDYTIELRDAGTVPYRHVAVTAMLPPGFHILRASPALAASAGPGSMPTWTADLLPGRTV
FT                   DIHAEITAGTVQDLAEAAEPLTGPSDVLDGSGPGSGSSSGAMAWYSLSACAQSGPSGVP
FT                   VCGLSRQLLVKTDDDTRRGIEAMVLILGVPLLVGGLGVYAWRARREPDMD"
     MGAATALTLL GPAAASAAAD TTPAPPAGVT VDVLGGSTPA DEHAAIDYTI ELRDAGTVPY        60
     RHVAVTAMLP PGFHILRASP ALAASAGPGS MPTWTADLLP GRTVDIHAEI TAGTVQDLAE       120
     AAEPLTGPSD VLDGSGPGSG SSSGAMAWYS LSACAQSGPS GVPVCGLSRQ LLVKTDDDTR       180
     RGIEAMVLIL GVPLLVGGLG VYAWRARREP DMD                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page