(data stored in ACNUC7421 zone)

EMBL: CP001700.PE355

CP001700.PE355       Location/Qualifiers
FT   CDS             complement(401672..402214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0357"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: dge:Dgeo_2488 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69310"
FT                   /db_xref="GOA:C7PVF4"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF4"
FT                   /inference="similar to AA sequence:KEGG:Dgeo_2488"
FT                   /protein_id="ACU69310.1"
FT                   /translation="MDASVWIVNIVVLASVLGTDLGRRKVGMARLLRPAIVAAVIVPMY
FT                   VKHPATSGSGLVLELAAAALGLLLGLGAAALLKVRRNPSDGVIYTHAGVGYAALWTAVI
FT                   GARLLFVYGSNHWFTEQLGRWMTQHQISVDALTDALVVMAIAMLLGRTGTLAAKRRTAV
FT                   TGHVATGASAQRTQVVR"
     MDASVWIVNI VVLASVLGTD LGRRKVGMAR LLRPAIVAAV IVPMYVKHPA TSGSGLVLEL        60
     AAAALGLLLG LGAAALLKVR RNPSDGVIYT HAGVGYAALW TAVIGARLLF VYGSNHWFTE       120
     QLGRWMTQHQ ISVDALTDAL VVMAIAMLLG RTGTLAAKRR TAVTGHVATG ASAQRTQVVR       180
//

If you have problems or comments...

PBIL Back to PBIL home page