(data stored in ACNUC7421 zone)

EMBL: CP001700.PE356

CP001700.PE356       Location/Qualifiers
FT   CDS             402413..402868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0358"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   sma:SAV_5952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69311"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF5"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACU69311.1"
FT                   /translation="MHLMKSTDLALRLLMRLAVVPPDTHPDELPTTRGVAEAMGAASTH
FT                   MAKVVGKLQHLGLVQARRGRGGGLVLTPAGRVASVGAVVRTFEGSGDLAACVDGEDPCP
FT                   LNAACRLRSALRAAQEAFYASLDQLTVEDVTAAPTGPLLLSIAMGRP"
     MHLMKSTDLA LRLLMRLAVV PPDTHPDELP TTRGVAEAMG AASTHMAKVV GKLQHLGLVQ        60
     ARRGRGGGLV LTPAGRVASV GAVVRTFEGS GDLAACVDGE DPCPLNAACR LRSALRAAQE       120
     AFYASLDQLT VEDVTAAPTG PLLLSIAMGR P                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page