(data stored in ACNUC7421 zone)

EMBL: CP001700.PE357

CP001700.PE357       Location/Qualifiers
FT   CDS             complement(402891..404087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0359"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   globin; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: sgr:SGR_2266 putative flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69312"
FT                   /db_xref="GOA:C7PVF6"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF6"
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /protein_id="ACU69312.1"
FT                   /translation="MLSEQSAATVRATLPVVGAAIGDITERFYARLFQAHPELLRDLFN
FT                   RGNQAAGTQRLALAGSIAAFATQLVEQPGTRPDALLSRIAHKHASLGVSPAQYKVVHQH
FT                   LFAAIAEVLGDAVTPDVAAAWDEVYWLMAHALIAIEGRLSTERGYLVGGTWRDWEVVGR
FT                   REETADVASFLLRPVGGGTPQPFQAGQYVSVQVELPDGARQIRQYSLTSAPDAAVRQIG
FT                   VKRERGTDADPAGEVSNHLHDTVQPGHVLRISAPFGDLVVDAGASEQPLLLASAGIGVT
FT                   PMISILAELVNREHAAPVLVVHADRSPEAHALRSDQNILAAKLISGRTYYWYENDAGES
FT                   GRVGLADLSDVEIPAGTAAFLCGPLPFMRAMREQLLAKGVPAADIHYEVFGPDLWLAA"
     MLSEQSAATV RATLPVVGAA IGDITERFYA RLFQAHPELL RDLFNRGNQA AGTQRLALAG        60
     SIAAFATQLV EQPGTRPDAL LSRIAHKHAS LGVSPAQYKV VHQHLFAAIA EVLGDAVTPD       120
     VAAAWDEVYW LMAHALIAIE GRLSTERGYL VGGTWRDWEV VGRREETADV ASFLLRPVGG       180
     GTPQPFQAGQ YVSVQVELPD GARQIRQYSL TSAPDAAVRQ IGVKRERGTD ADPAGEVSNH       240
     LHDTVQPGHV LRISAPFGDL VVDAGASEQP LLLASAGIGV TPMISILAEL VNREHAAPVL       300
     VVHADRSPEA HALRSDQNIL AAKLISGRTY YWYENDAGES GRVGLADLSD VEIPAGTAAF       360
     LCGPLPFMRA MREQLLAKGV PAADIHYEVF GPDLWLAA                               398
//

If you have problems or comments...

PBIL Back to PBIL home page