(data stored in ACNUC7421 zone)

EMBL: CP001700.PE359

CP001700.PE359       Location/Qualifiers
FT   CDS             complement(404691..405515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0361"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   ret:RHE_PE00204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69314"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF8"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ACU69314.1"
FT                   /translation="MAPLIDYRSPGLFTDVRGVEPAALRGVATDPVDLIRPVSRLVIQP
FT                   HEAEAAGIAAERLAENQIRPAAVLVERLLAVDAAPLSEPREAGKRVVGTCRHFAVLACA
FT                   LLRNAGYAARARCGFATYFQPGQALDHWVIEYRLDDAAHWIRLDPETLGGSVLPNADDL
FT                   SPGDFLTGAEAWAAYRRGEVDGATFGVHGTENFGPAEIKGNAVRDLAAMNKVETLPWDE
FT                   WGRMTDAYAGLTGEDYDALLDELAAACASDDDRALSELYRDPVFEVPAELLL"
     MAPLIDYRSP GLFTDVRGVE PAALRGVATD PVDLIRPVSR LVIQPHEAEA AGIAAERLAE        60
     NQIRPAAVLV ERLLAVDAAP LSEPREAGKR VVGTCRHFAV LACALLRNAG YAARARCGFA       120
     TYFQPGQALD HWVIEYRLDD AAHWIRLDPE TLGGSVLPNA DDLSPGDFLT GAEAWAAYRR       180
     GEVDGATFGV HGTENFGPAE IKGNAVRDLA AMNKVETLPW DEWGRMTDAY AGLTGEDYDA       240
     LLDELAAACA SDDDRALSEL YRDPVFEVPA ELLL                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page