(data stored in ACNUC7421 zone)

EMBL: CP001700.PE36

CP001700.PE36        Location/Qualifiers
FT   CDS             36782..38761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0036"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: sgr:SGR_3727
FT                   FtsW/RodA/SpoVE family cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68991"
FT                   /db_xref="GOA:C7QFQ2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ2"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACU68991.1"
FT                   /translation="MSAAPPRPEEPLIPKRRNTELLLSLFAVAVAMFAYANVGLADNGK
FT                   LPAGMWGVGAGLVVVVLVANGLTRYAAPYADPLFLPLTIFLNGIGLVLIHRLDIYDTEH
FT                   FQALHKLNPVKYHTPPTGSTTNQLMYTALGIIVMAGFLLFIKDHKVLQRYAYISMVSGL
FT                   FLVALPAMLPASMSSRNGAKSWVFLPGGVSIQPAEFGKLLLVSFFAAFLMAKRDALRVA
FT                   SRRVLGLNIPRGRDMGPIAVCWVLAMLILVFETDLGVSLMFFGAFVVLLYIATERTSWL
FT                   VFGVTAFIGGAVFIATTVPHVQARVNNWLHPFTGEICARTAAPGTNCPSDQISQSIYGF
FT                   ATGGIFGKGLDQGRPWLVGFAKNADFILVTVGEELGMVGLFALMMVYTLFVMRGFKTAL
FT                   LIRDNYGKLLAAGLSVTFALQVFITAGGVMRVIPLTGLPMPFLAAGGSALVANWVVVAL
FT                   LIRLSDSARRPLPPAIPLTDDELRAMRLAAAQKMPSNAAPARHAQPAAQTPAGGPPRPH
FT                   PLAQPGLGQTGLAQSGLDQTGLDTPSGSEEPAPPGASDPTEPMPVRRVAAAGAGADDVT
FT                   QAVPSQPRGYGEQTMLRAAEATQAMQATSGPRAEPEQGATESYTPAFEDEDDDDVRTRP
FT                   TPAPGANPGEVPGRPGPTERRYGP"
     MSAAPPRPEE PLIPKRRNTE LLLSLFAVAV AMFAYANVGL ADNGKLPAGM WGVGAGLVVV        60
     VLVANGLTRY AAPYADPLFL PLTIFLNGIG LVLIHRLDIY DTEHFQALHK LNPVKYHTPP       120
     TGSTTNQLMY TALGIIVMAG FLLFIKDHKV LQRYAYISMV SGLFLVALPA MLPASMSSRN       180
     GAKSWVFLPG GVSIQPAEFG KLLLVSFFAA FLMAKRDALR VASRRVLGLN IPRGRDMGPI       240
     AVCWVLAMLI LVFETDLGVS LMFFGAFVVL LYIATERTSW LVFGVTAFIG GAVFIATTVP       300
     HVQARVNNWL HPFTGEICAR TAAPGTNCPS DQISQSIYGF ATGGIFGKGL DQGRPWLVGF       360
     AKNADFILVT VGEELGMVGL FALMMVYTLF VMRGFKTALL IRDNYGKLLA AGLSVTFALQ       420
     VFITAGGVMR VIPLTGLPMP FLAAGGSALV ANWVVVALLI RLSDSARRPL PPAIPLTDDE       480
     LRAMRLAAAQ KMPSNAAPAR HAQPAAQTPA GGPPRPHPLA QPGLGQTGLA QSGLDQTGLD       540
     TPSGSEEPAP PGASDPTEPM PVRRVAAAGA GADDVTQAVP SQPRGYGEQT MLRAAEATQA       600
     MQATSGPRAE PEQGATESYT PAFEDEDDDD VRTRPTPAPG ANPGEVPGRP GPTERRYGP        659
//

If you have problems or comments...

PBIL Back to PBIL home page