(data stored in ACNUC7421 zone)

EMBL: CP001700.PE360

CP001700.PE360       Location/Qualifiers
FT   CDS             complement(405526..406497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0362"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sma:SAV_3810 epoxide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69315"
FT                   /db_xref="GOA:C7PVF9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF9"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69315.1"
FT                   /translation="MNKRSVMVGGLRMNVVEAGSGPDVVVLLHGFLNYSYSWRHQVRDL
FT                   AAAGYRVLAPDLRGYGETGCPEDVEQYSMLHLVADVVGLLDAFGIERATVVGHDWGSVL
FT                   AWHTALLRPDRVRGVVGLSVPYVPRADISLLTAMRERFGDLYYMQYFQEVGPADRELAR
FT                   DVAATFRSVLSSGSEPWNPVLPEGGGWLDCLPDKGIPDWLTAADLDAHVAAFERSGFTG
FT                   ALNWYRNIDRNHELTAAWQGAKIQVPALFLYGTRDAFGRYASELIDDLPRSVPDLRSVV
FT                   RLDAGHWVQQERPDEVTAALVDFLERDRDRDGARPMPVGAAL"
     MNKRSVMVGG LRMNVVEAGS GPDVVVLLHG FLNYSYSWRH QVRDLAAAGY RVLAPDLRGY        60
     GETGCPEDVE QYSMLHLVAD VVGLLDAFGI ERATVVGHDW GSVLAWHTAL LRPDRVRGVV       120
     GLSVPYVPRA DISLLTAMRE RFGDLYYMQY FQEVGPADRE LARDVAATFR SVLSSGSEPW       180
     NPVLPEGGGW LDCLPDKGIP DWLTAADLDA HVAAFERSGF TGALNWYRNI DRNHELTAAW       240
     QGAKIQVPAL FLYGTRDAFG RYASELIDDL PRSVPDLRSV VRLDAGHWVQ QERPDEVTAA       300
     LVDFLERDRD RDGARPMPVG AAL                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page