(data stored in ACNUC7421 zone)

EMBL: CP001700.PE361

CP001700.PE361       Location/Qualifiers
FT   CDS             407168..409477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0363"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   sgr:SGR_935 putative sensor-like histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69316"
FT                   /db_xref="GOA:C7PVG0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69316.1"
FT                   /translation="MTAADRVQEAPPRPGHGAPGRHSAYNAAGAERRPAGRRPTAWVVA
FT                   PSVCSAVLAGAAIVLVVDGAHSAGYHISSGTMTAVWVLGGLILAVVAATLAFAGRPGRA
FT                   TEIPAFGGPDPRQAPPPMAQPQPQPQPQPHQQPQHQQHRPQPAPAPLPQQAPPPPPMSP
FT                   QVVANATEAAATLAAATKAAAGPIAVSEEGVDLQVIFAQLVRRLLTLVLQQINRLDELE
FT                   NEVEDPKLLKSLFGIDHQATQVRRYGENIGVLVGALPQRQWTHPVPVTVAQRSAVSETP
FT                   DYPRVQVIPRAPGRIHGHAVSDVIHILSELVENATNYSNPTTKVTVGAHRVSAGLAIEI
FT                   NDHGIGMESDQFRRLNTLLRDPSGANVKDLLSQGRIGLSVVAKMAQRHGIAVELAPNVT
FT                   GGTMALVVIPDALLAAEELPADKGHQPRRGIDHTQLPARPALAPLPDTLPPATTSSTAS
FT                   TAATAPSSAASLSPVAASMPPPLSSPATAHVPPLPTSPAAAAQESARAGQPTPIRATPP
FT                   PLPTSPLPTSPAAADQAARTAQQGYAQPDSFQSGQGRQAWSQPAPAEPQWPSINPPVTG
FT                   GASAPTAAAPVPGPTGSVASFQAPSADMYQGSELGAAAPAQTDRYPAQDFGTPAPAQPD
FT                   RYSLQGPDTAVLPLTPDRYPAPGTGTSVPPWSRLGDRSAAGEQASEPASEKAPGLLPDG
FT                   RPQLRRRTPQGHISARLLQAEPQENPHGGGALSPTMMSDFWQGLSSGIAPAGPPAAGAD
FT                   PSQHDRTTANRQEWNQ"
     MTAADRVQEA PPRPGHGAPG RHSAYNAAGA ERRPAGRRPT AWVVAPSVCS AVLAGAAIVL        60
     VVDGAHSAGY HISSGTMTAV WVLGGLILAV VAATLAFAGR PGRATEIPAF GGPDPRQAPP       120
     PMAQPQPQPQ PQPHQQPQHQ QHRPQPAPAP LPQQAPPPPP MSPQVVANAT EAAATLAAAT       180
     KAAAGPIAVS EEGVDLQVIF AQLVRRLLTL VLQQINRLDE LENEVEDPKL LKSLFGIDHQ       240
     ATQVRRYGEN IGVLVGALPQ RQWTHPVPVT VAQRSAVSET PDYPRVQVIP RAPGRIHGHA       300
     VSDVIHILSE LVENATNYSN PTTKVTVGAH RVSAGLAIEI NDHGIGMESD QFRRLNTLLR       360
     DPSGANVKDL LSQGRIGLSV VAKMAQRHGI AVELAPNVTG GTMALVVIPD ALLAAEELPA       420
     DKGHQPRRGI DHTQLPARPA LAPLPDTLPP ATTSSTASTA ATAPSSAASL SPVAASMPPP       480
     LSSPATAHVP PLPTSPAAAA QESARAGQPT PIRATPPPLP TSPLPTSPAA ADQAARTAQQ       540
     GYAQPDSFQS GQGRQAWSQP APAEPQWPSI NPPVTGGASA PTAAAPVPGP TGSVASFQAP       600
     SADMYQGSEL GAAAPAQTDR YPAQDFGTPA PAQPDRYSLQ GPDTAVLPLT PDRYPAPGTG       660
     TSVPPWSRLG DRSAAGEQAS EPASEKAPGL LPDGRPQLRR RTPQGHISAR LLQAEPQENP       720
     HGGGALSPTM MSDFWQGLSS GIAPAGPPAA GADPSQHDRT TANRQEWNQ                   769
//

If you have problems or comments...

PBIL Back to PBIL home page