(data stored in ACNUC7421 zone)

EMBL: CP001700.PE362

CP001700.PE362       Location/Qualifiers
FT   CDS             409474..409905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0364"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   sma:SAV_1632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69317"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG1"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ACU69317.1"
FT                   /translation="MSTQTEENLSWLINRMLQSIPAARSVLLMSTDGLVRAYTTGLNKD
FT                   EADTLAAAESGMWGIVTAIGKTVRAGGVRQVVVELDGAFLCVGAAGPGTCIGVLADREA
FT                   DPRQIGFEMQRCVTAVVRELSTAPRGAADGAVAAARARS"
     MSTQTEENLS WLINRMLQSI PAARSVLLMS TDGLVRAYTT GLNKDEADTL AAAESGMWGI        60
     VTAIGKTVRA GGVRQVVVEL DGAFLCVGAA GPGTCIGVLA DREADPRQIG FEMQRCVTAV       120
     VRELSTAPRG AADGAVAAAR ARS                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page