(data stored in ACNUC7421 zone)

EMBL: CP001700.PE364

CP001700.PE364       Location/Qualifiers
FT   CDS             410254..410889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0366"
FT                   /product="protein of unknown function ATP binding"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   tfu:Tfu_2447 putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69319"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG3"
FT                   /inference="protein motif:PFAM:PF03029"
FT                   /protein_id="ACU69319.1"
FT                   /translation="MPSTSSDRASENLPGGLKLLIAGGFGVGKTTLVGAVSEIAPLKTE
FT                   ATITEASVGVDDIALTGGKTTTTVALDFGRISIANEYVLFLFGMPGQERFWFMWDQLCI
FT                   GALGVIVLVDTRRIEDSFEAVDYFERTGIPFLVAVNEFEGARFAYTSVEVREALQLRAE
FT                   VPVVMCDARSRTSAVNVLIALVKHLQSTDFRPVRPAAPELAAHEGSYI"
     MPSTSSDRAS ENLPGGLKLL IAGGFGVGKT TLVGAVSEIA PLKTEATITE ASVGVDDIAL        60
     TGGKTTTTVA LDFGRISIAN EYVLFLFGMP GQERFWFMWD QLCIGALGVI VLVDTRRIED       120
     SFEAVDYFER TGIPFLVAVN EFEGARFAYT SVEVREALQL RAEVPVVMCD ARSRTSAVNV       180
     LIALVKHLQS TDFRPVRPAA PELAAHEGSY I                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page