(data stored in ACNUC7421 zone)

EMBL: CP001700.PE365

CP001700.PE365       Location/Qualifiers
FT   CDS             410886..411854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0367"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; SMART: GAF domain protein;
FT                   KEGG: sma:SAV_1629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69320"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG4"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACU69320.1"
FT                   /translation="MTDRDDFQTPALRLGQPAPSDAAARAARQRELSLSATADSVFDEV
FT                   ARRAAEATGATAAMVNMVGENGQYLVGLYGKEPGSGEAAFLGDPGRYAAMDQGFCVHVV
FT                   GRKAALTLDDVFDFSRFRGNPIVDELGVRSYIGVPLIDDGGTVIGTVCAIDPAPRSESD
FT                   GNSWGNQGLQVLKAARDEVLAEISGRQKIAAILENAGGTAMIAARPGLEVLYANTLHDQ
FT                   LFGAVQVLGTPALEAFPHLAPVGILAVIETLDRGGEPTTTAPIPLSEPATGSVIFAAVP
FT                   VRVPGHASAVLTLGLRDSDAATVLNRAAQIAADIGALSDTR"
     MTDRDDFQTP ALRLGQPAPS DAAARAARQR ELSLSATADS VFDEVARRAA EATGATAAMV        60
     NMVGENGQYL VGLYGKEPGS GEAAFLGDPG RYAAMDQGFC VHVVGRKAAL TLDDVFDFSR       120
     FRGNPIVDEL GVRSYIGVPL IDDGGTVIGT VCAIDPAPRS ESDGNSWGNQ GLQVLKAARD       180
     EVLAEISGRQ KIAAILENAG GTAMIAARPG LEVLYANTLH DQLFGAVQVL GTPALEAFPH       240
     LAPVGILAVI ETLDRGGEPT TTAPIPLSEP ATGSVIFAAV PVRVPGHASA VLTLGLRDSD       300
     AATVLNRAAQ IAADIGALSD TR                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page