(data stored in ACNUC7421 zone)

EMBL: CP001700.PE366

CP001700.PE366       Location/Qualifiers
FT   CDS             complement(411918..412919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0368"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: sma:SAV_609 3-oxoacyl-(acyl carrier protein)
FT                   synthase III; TIGRFAM: 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; 3-Oxoacyl-[acyl-carrier-
FT                   protein (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69321"
FT                   /db_xref="GOA:C7PVG5"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG5"
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /protein_id="ACU69321.1"
FT                   /translation="MTKAAVISGIGSSVPASVVTNDMLAERLDTTDDWIRRLTGIQTRH
FT                   WIEPGQATSDLAVEAGSRAIESAGGEPPQAVVLATITPDRPCPATAPEVASRLGLEGVA
FT                   AFDVAAVCSGFVYGLATGTGLIAAGIAERVLVIGADTISTILDPTDRSTGVIFGDGAGA
FT                   VMLRAGEADEPGALQALDLGSDGTGTDLITVPAGGSRQRSTKSVPPTTDTYLKMAGREV
FT                   FRESVRRMVESCEAVLERTGWDAADVDRLVPHQANLRIMNSVADRLGMPRDRAVVDLDR
FT                   VGNTSAASIPLALARAAAEGTVESGHRLLLTAFGGGLTWGSATLTWPDIKPV"
     MTKAAVISGI GSSVPASVVT NDMLAERLDT TDDWIRRLTG IQTRHWIEPG QATSDLAVEA        60
     GSRAIESAGG EPPQAVVLAT ITPDRPCPAT APEVASRLGL EGVAAFDVAA VCSGFVYGLA       120
     TGTGLIAAGI AERVLVIGAD TISTILDPTD RSTGVIFGDG AGAVMLRAGE ADEPGALQAL       180
     DLGSDGTGTD LITVPAGGSR QRSTKSVPPT TDTYLKMAGR EVFRESVRRM VESCEAVLER       240
     TGWDAADVDR LVPHQANLRI MNSVADRLGM PRDRAVVDLD RVGNTSAASI PLALARAAAE       300
     GTVESGHRLL LTAFGGGLTW GSATLTWPDI KPV                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page