(data stored in ACNUC7421 zone)

EMBL: CP001700.PE367

CP001700.PE367       Location/Qualifiers
FT   CDS             complement(412969..413247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0369"
FT                   /product="phosphopantetheine-binding"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG: sco:SCO0549
FT                   acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69322"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG6"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ACU69322.1"
FT                   /translation="MESYQHVLDTLRVIIEGSVDEVAAGDITADSDLAGELGVDSLAMF
FT                   EIADKAQERWNIKISDDDISRFTTVESLATFIQAAVGAQGLPAMTEA"
     MESYQHVLDT LRVIIEGSVD EVAAGDITAD SDLAGELGVD SLAMFEIADK AQERWNIKIS        60
     DDDISRFTTV ESLATFIQAA VGAQGLPAMT EA                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page