(data stored in ACNUC7421 zone)

EMBL: CP001700.PE368

CP001700.PE368       Location/Qualifiers
FT   CDS             complement(413303..414853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0370"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: npu:Npun_R2083
FT                   AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69323"
FT                   /db_xref="GOA:C7PVG7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG7"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU69323.1"
FT                   /translation="MTADGMIAFLRQYADDRLDSWLMDERRSLPLSLISHLGSEGLFGL
FT                   RVDRRYGGRELSHTDTFRVIRQAAAIDPNLAVLLAVHNSLGIPPVRDYADEETKQRVLP
FT                   TLATGRGLVTVASSEPGMGSNVVRGMATTAIRQADRSFIVNGKKSWISLGAASSHITVL
FT                   ARLQEPNGRRRGITAFLLPTSTPGFRPRSEAMTIGLRAVPQDHITLDNMRLPPSAVLGA
FT                   EGGGAALAQNSFRMGRAFLAASGTGAMQRCIQLAERFAGRRGISTGRLLDNGVTQRILA
FT                   DCAAATRTVEALVFSLAERLDRGGPVPDEFFFACKVIGCELAGQVVDQCVQLMGARGFV
FT                   DTDIVGKYFRDFRVLRIFEGATEAMSVFVGTRIVRDLESFHTTMVKTFGATKLESDLMA
FT                   GLHDLVERAGSGLTPQQGHVLARAVGDVACWGVTAAAIAETAENSHGDLDVYAAYWAAR
FT                   QLEQRLASARNELRPAFALSANVLARHIAEYADSIGDTQQSYGGERRAVDAFLHRDPA"
     MTADGMIAFL RQYADDRLDS WLMDERRSLP LSLISHLGSE GLFGLRVDRR YGGRELSHTD        60
     TFRVIRQAAA IDPNLAVLLA VHNSLGIPPV RDYADEETKQ RVLPTLATGR GLVTVASSEP       120
     GMGSNVVRGM ATTAIRQADR SFIVNGKKSW ISLGAASSHI TVLARLQEPN GRRRGITAFL       180
     LPTSTPGFRP RSEAMTIGLR AVPQDHITLD NMRLPPSAVL GAEGGGAALA QNSFRMGRAF       240
     LAASGTGAMQ RCIQLAERFA GRRGISTGRL LDNGVTQRIL ADCAAATRTV EALVFSLAER       300
     LDRGGPVPDE FFFACKVIGC ELAGQVVDQC VQLMGARGFV DTDIVGKYFR DFRVLRIFEG       360
     ATEAMSVFVG TRIVRDLESF HTTMVKTFGA TKLESDLMAG LHDLVERAGS GLTPQQGHVL       420
     ARAVGDVACW GVTAAAIAET AENSHGDLDV YAAYWAARQL EQRLASARNE LRPAFALSAN       480
     VLARHIAEYA DSIGDTQQSY GGERRAVDAF LHRDPA                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page