(data stored in ACNUC7421 zone)

EMBL: CP001700.PE37

CP001700.PE37        Location/Qualifiers
FT   CDS             38758..40230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0037"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: sma:SAV_4339 penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68992"
FT                   /db_xref="GOA:C7QFQ3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ3"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACU68992.1"
FT                   /translation="MNQPIRRVAIFCFLLIASLLVSSNYLQVVNADSYKARAGNQRTEL
FT                   DYYAYPRGKILTADGTVIADSVPSGGLQYKYQRTYPLKADYANITGWKSIVYGSRDIEN
FT                   VLDKYLQGTDSSESVANFMDTLTGKSKKGGDVQLTLQNAVQQAAIKGLGKQNGSVVALD
FT                   PTTGAILAMYSSPSFDPNGIASNVSETSTAAGNALEADKGKPNLNHAIGENYPPGSVFK
FT                   IVTAAAALDSGKFTETGSTGADPNFYSNGSGYKLKNEDGTCSGTDLKTALAESCNSVYG
FT                   FVGATLGSQIMSTYASKFGFNDPSLKIPLQVAQSNFPSPATVGTNVLGLAQDSIGQGDT
FT                   QVTPLQAAMIAAAVANGGTIMQPYMVDKETAPNGHVTYKGSDHQHELSQAMSPATAATL
FT                   DDMMQNVVTHGTAQGRGIPGVQMGAKTGTAQRASGQNPLAWFVCYGTANGKKVAVAVMV
FT                   DTNDPSIRSDVSGVNFAGPTAQAVLKAALGVG"
     MNQPIRRVAI FCFLLIASLL VSSNYLQVVN ADSYKARAGN QRTELDYYAY PRGKILTADG        60
     TVIADSVPSG GLQYKYQRTY PLKADYANIT GWKSIVYGSR DIENVLDKYL QGTDSSESVA       120
     NFMDTLTGKS KKGGDVQLTL QNAVQQAAIK GLGKQNGSVV ALDPTTGAIL AMYSSPSFDP       180
     NGIASNVSET STAAGNALEA DKGKPNLNHA IGENYPPGSV FKIVTAAAAL DSGKFTETGS       240
     TGADPNFYSN GSGYKLKNED GTCSGTDLKT ALAESCNSVY GFVGATLGSQ IMSTYASKFG       300
     FNDPSLKIPL QVAQSNFPSP ATVGTNVLGL AQDSIGQGDT QVTPLQAAMI AAAVANGGTI       360
     MQPYMVDKET APNGHVTYKG SDHQHELSQA MSPATAATLD DMMQNVVTHG TAQGRGIPGV       420
     QMGAKTGTAQ RASGQNPLAW FVCYGTANGK KVAVAVMVDT NDPSIRSDVS GVNFAGPTAQ       480
     AVLKAALGVG                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page