(data stored in ACNUC7421 zone)

EMBL: CP001700.PE370

CP001700.PE370       Location/Qualifiers
FT   CDS             complement(415643..416230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69325"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69325.1"
FT                   /translation="MSAPPVLRDVYRTLMAARGDAAASLTFDDGPGPIARLDVFVYRPA
FT                   EPAGLTTFATVGMATAPMPTADGAEGSRAELLLSRSGELAPEDEQQIAMQLANLAVYPW
FT                   KTGRAVGWAQIVGFEQDFPTFPGCPAVFLAGPLLKDTPNWIDTCEGAVQVITVVPITEA
FT                   ERASAASMPPKTFAGNLIEARDVFTAPPVVGA"
     MSAPPVLRDV YRTLMAARGD AAASLTFDDG PGPIARLDVF VYRPAEPAGL TTFATVGMAT        60
     APMPTADGAE GSRAELLLSR SGELAPEDEQ QIAMQLANLA VYPWKTGRAV GWAQIVGFEQ       120
     DFPTFPGCPA VFLAGPLLKD TPNWIDTCEG AVQVITVVPI TEAERASAAS MPPKTFAGNL       180
     IEARDVFTAP PVVGA                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page