(data stored in ACNUC7421 zone)

EMBL: CP001700.PE371

CP001700.PE371       Location/Qualifiers
FT   CDS             416438..418825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0373"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   Fibronectin type III domain protein; SMART: Fibronectin
FT                   type III domain protein; coagulation factor 5/8 type domain
FT                   protein; KEGG: sco:SCO7015 secreted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69326"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH0"
FT                   /inference="protein motif:PFAM:PF00754"
FT                   /protein_id="ACU69326.1"
FT                   /translation="MTVTRRRFLTTAAAGSAAALLAGPDLLAAPAARAASPAGDVVGKI
FT                   TVGYQGWFACAGDGAPIGGWWHWAQNWAQTPSPSNNVIKAWPDMREYTHAYQTAYSNLG
FT                   NGQPATLFSSYDQQTVDTHFLWMQQNGCDTAALQRFNPNSSEGPTRDAMATKVRSSAET
FT                   HSRKFYIMYDVTGWTAMQAEIKADWTSKMSALTASSAYAHQNGKPVVGIWGFGFNDANH
FT                   PWDAATCLDVITWFKSQGCYVMGGVPREWRTGTGGSRAGYLGVYHAFDMLSPWMVGAIG
FT                   TAADSDNAYTNLTVPDLADCTANNVDYQPCVLPGDLSGRQRVHGDFMWRQFYNMARAGT
FT                   QSVYISMFDEYGEGNQIAKTAENQSMSPNGAGLLALDEDGTACSSDYYLRLTADGGRML
FT                   KGQIPLTATRPTQPVAGSGGGSGNLALGKPASASGTSQNFGPGNAVDGDPNTYWESVNN
FT                   AFPQWFQVDLGSVAAVGSVVMKLPASWGARTQTLALAGSSDGSTFSTLAASAGRTFDPA
FT                   TGNTVTINVGTASVRYLRATFTANTGWPAGQLSEFQVFAPTSGGGGDTTPPTAPTNLAV
FT                   TGHTSSSVSLSWTASTDNIGVTGYQVRVNGTTALTVTKTTATVTGLSPSTAYSFAVVAT
FT                   DALGNVSLPSATVSATTDPATNANLALGKPTSESGHTQSYASSNTVDGDANTYWESVDN
FT                   AFPQWLMVDLGAVTSVSRVVLKLPPATAWAARTQTVAVTGGADASAASTLSASAGRLFD
FT                   PATGNSVTITFPATSVRYVRLTFTANTGWPAGQISEFQVYAS"
     MTVTRRRFLT TAAAGSAAAL LAGPDLLAAP AARAASPAGD VVGKITVGYQ GWFACAGDGA        60
     PIGGWWHWAQ NWAQTPSPSN NVIKAWPDMR EYTHAYQTAY SNLGNGQPAT LFSSYDQQTV       120
     DTHFLWMQQN GCDTAALQRF NPNSSEGPTR DAMATKVRSS AETHSRKFYI MYDVTGWTAM       180
     QAEIKADWTS KMSALTASSA YAHQNGKPVV GIWGFGFNDA NHPWDAATCL DVITWFKSQG       240
     CYVMGGVPRE WRTGTGGSRA GYLGVYHAFD MLSPWMVGAI GTAADSDNAY TNLTVPDLAD       300
     CTANNVDYQP CVLPGDLSGR QRVHGDFMWR QFYNMARAGT QSVYISMFDE YGEGNQIAKT       360
     AENQSMSPNG AGLLALDEDG TACSSDYYLR LTADGGRMLK GQIPLTATRP TQPVAGSGGG       420
     SGNLALGKPA SASGTSQNFG PGNAVDGDPN TYWESVNNAF PQWFQVDLGS VAAVGSVVMK       480
     LPASWGARTQ TLALAGSSDG STFSTLAASA GRTFDPATGN TVTINVGTAS VRYLRATFTA       540
     NTGWPAGQLS EFQVFAPTSG GGGDTTPPTA PTNLAVTGHT SSSVSLSWTA STDNIGVTGY       600
     QVRVNGTTAL TVTKTTATVT GLSPSTAYSF AVVATDALGN VSLPSATVSA TTDPATNANL       660
     ALGKPTSESG HTQSYASSNT VDGDANTYWE SVDNAFPQWL MVDLGAVTSV SRVVLKLPPA       720
     TAWAARTQTV AVTGGADASA ASTLSASAGR LFDPATGNSV TITFPATSVR YVRLTFTANT       780
     GWPAGQISEF QVYAS                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page