(data stored in ACNUC7421 zone)

EMBL: CP001700.PE372

CP001700.PE372       Location/Qualifiers
FT   CDS             complement(418891..419883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0374"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: fal:FRAAL3598
FT                   LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69327"
FT                   /db_xref="GOA:C7PVH1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH1"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACU69327.1"
FT                   /translation="MDLDLAQVRAFVAAAERLHFGQAAEQLAVSQQALSKRIARLEGEL
FT                   GVQLFLRGGHAVELTDAGRRFLEPARQTLAHGDAAVAAARHVERPLRIDYWGHLFAPMR
FT                   TLAPVIERVGGAVTVETGPGRDLPGVLDALDRSATDVGFGRVHGVGGGVGSGGGGTRDA
FT                   AYTHRLVRLEPVDVVISEDHRLAGQSEVRPAELRDSVLWCPAALNRLDFFQRFAEHFDI
FT                   TAESGTANLGIDRFLEQVAADPVRFALIPADLELPERTRVRSLPLVEPTPLYAWSLVWR
FT                   AADPHPGIEPLLRAFADVAGRSRWLEYQPGRDWLPAGDVSEVWHPAERK"
     MDLDLAQVRA FVAAAERLHF GQAAEQLAVS QQALSKRIAR LEGELGVQLF LRGGHAVELT        60
     DAGRRFLEPA RQTLAHGDAA VAAARHVERP LRIDYWGHLF APMRTLAPVI ERVGGAVTVE       120
     TGPGRDLPGV LDALDRSATD VGFGRVHGVG GGVGSGGGGT RDAAYTHRLV RLEPVDVVIS       180
     EDHRLAGQSE VRPAELRDSV LWCPAALNRL DFFQRFAEHF DITAESGTAN LGIDRFLEQV       240
     AADPVRFALI PADLELPERT RVRSLPLVEP TPLYAWSLVW RAADPHPGIE PLLRAFADVA       300
     GRSRWLEYQP GRDWLPAGDV SEVWHPAERK                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page