(data stored in ACNUC7421 zone)

EMBL: CP001700.PE373

CP001700.PE373       Location/Qualifiers
FT   CDS             420005..420925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0375"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mlo:mlr3236 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69328"
FT                   /db_xref="GOA:C7PVH2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH2"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACU69328.1"
FT                   /translation="MKAMTATGRTEPSVALTAVDQPQPRPDEALVKVEAYSVNRGETFQ
FT                   LEAPRPGWRPGKDVAGLVVQAAADGSGPAVGARVVGHPPQGGWAEYVAVPTSSLADLPD
FT                   TVPAATAAALPLAGLTALRLLRVTRAAAGSRVLMTGASGGVGHYFVELAAAAGLEITAV
FT                   SSSPERGARLLELGAARVVPSIDAAEGPFDIVLESTGGPNLPAALAKLARRGTLIWFGQ
FT                   ASRQPATLDFFDFFAGPESATIRHFHYADSDSTYGQDLQTLVRLVAADRLHPEIGLVTD
FT                   WTGTADVLTLLRDRGVRGNAVLTIA"
     MKAMTATGRT EPSVALTAVD QPQPRPDEAL VKVEAYSVNR GETFQLEAPR PGWRPGKDVA        60
     GLVVQAAADG SGPAVGARVV GHPPQGGWAE YVAVPTSSLA DLPDTVPAAT AAALPLAGLT       120
     ALRLLRVTRA AAGSRVLMTG ASGGVGHYFV ELAAAAGLEI TAVSSSPERG ARLLELGAAR       180
     VVPSIDAAEG PFDIVLESTG GPNLPAALAK LARRGTLIWF GQASRQPATL DFFDFFAGPE       240
     SATIRHFHYA DSDSTYGQDL QTLVRLVAAD RLHPEIGLVT DWTGTADVLT LLRDRGVRGN       300
     AVLTIA                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page