(data stored in ACNUC7421 zone)

EMBL: CP001700.PE374

CP001700.PE374       Location/Qualifiers
FT   CDS             420994..421407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0376"
FT                   /product="Limonene-12-epoxide hydrolase"
FT                   /note="PFAM: Limonene-12-epoxide hydrolase; KEGG:
FT                   fal:FRAAL3597 delta-5-3-ketosteroid isomerase- like protein
FT                   (fragment) (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69329"
FT                   /db_xref="GOA:C7PVH3"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH3"
FT                   /inference="protein motif:PFAM:PF07858"
FT                   /protein_id="ACU69329.1"
FT                   /translation="MTTITDPKTVVVRYVEAVRDGDTETIVASFAEHATWLYPGNLPIS
FT                   RLWEGRDAIINDFLGGMGAYLDTSAPVVIALVHAFADGDQVLAEWTSKATAANGATYDN
FT                   RCAAVFTVEDGKITSVREYADTHHVAAVLFGEA"
     MTTITDPKTV VVRYVEAVRD GDTETIVASF AEHATWLYPG NLPISRLWEG RDAIINDFLG        60
     GMGAYLDTSA PVVIALVHAF ADGDQVLAEW TSKATAANGA TYDNRCAAVF TVEDGKITSV       120
     REYADTHHVA AVLFGEA                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page