(data stored in ACNUC7421 zone)

EMBL: CP001700.PE376

CP001700.PE376       Location/Qualifiers
FT   CDS             complement(422022..422486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0378"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: sco:SCO7709 MarR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69331"
FT                   /db_xref="GOA:C7PVH5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH5"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69331.1"
FT                   /translation="MNATPADPPPPAVEDVATHLRSAVGTLVRSTRAVDRIAPIPAAVL
FT                   DLLAARGPMTTADLASSRGVRHQTMAATVKDLADAGFLSAGPDPDDARKKILALTEAGR
FT                   HALDADRRQRTVLLAAALDQALDADELRVLARALDLLDRVSVAVNQMTAT"
     MNATPADPPP PAVEDVATHL RSAVGTLVRS TRAVDRIAPI PAAVLDLLAA RGPMTTADLA        60
     SSRGVRHQTM AATVKDLADA GFLSAGPDPD DARKKILALT EAGRHALDAD RRQRTVLLAA       120
     ALDQALDADE LRVLARALDL LDRVSVAVNQ MTAT                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page