(data stored in ACNUC7421 zone)

EMBL: CP001700.PE377

CP001700.PE377       Location/Qualifiers
FT   CDS             422561..423196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO7708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69332"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH6"
FT                   /inference="similar to AA sequence:KEGG:SCO7708"
FT                   /protein_id="ACU69332.1"
FT                   /translation="MQLIKHAHACVSLVGDQGRIVIDPGTLTPDAAAAVAAAEAVLITH
FT                   EHFDHFDEDMLAKALDARPELRVYGPASVVGRWEARRGQVTAVAAGDRHAVAGFDIAVF
FT                   GELHALIHRDVPRVTNVGYLVDEKLYHPGDAYHVPEAPVETLLLPTSGPWTKLGEAVDY
FT                   VREVAPKQAVQIHELLLAEVGQQAAKTMIGNLTEAAMAIVPVGEAITV"
     MQLIKHAHAC VSLVGDQGRI VIDPGTLTPD AAAAVAAAEA VLITHEHFDH FDEDMLAKAL        60
     DARPELRVYG PASVVGRWEA RRGQVTAVAA GDRHAVAGFD IAVFGELHAL IHRDVPRVTN       120
     VGYLVDEKLY HPGDAYHVPE APVETLLLPT SGPWTKLGEA VDYVREVAPK QAVQIHELLL       180
     AEVGQQAAKT MIGNLTEAAM AIVPVGEAIT V                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page