(data stored in ACNUC7421 zone)

EMBL: CP001700.PE378

CP001700.PE378       Location/Qualifiers
FT   CDS             complement(423278..423928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0380"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sgr:SGR_3047
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69333"
FT                   /db_xref="GOA:C7PVH7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69333.1"
FT                   /translation="MVQTETGTPRQRYRAQVQEEIKQHAWEQIATAGASALSLNAIAKQ
FT                   MGMSGPALYRYFANRDELITALIRDAYQSMADAMRAAVADGAGLRGLARTLREWALEDP
FT                   QRYLLIYGTPVPGYQAPEDTTRLANDVMALLLDASSAEGLGALPPSPVQTHLEQHSPWA
FT                   GAHAGEGTTLHRAVILWTRLHGVLSLELAGHFAGMEFDPALLYAAEVEAVAGY"
     MVQTETGTPR QRYRAQVQEE IKQHAWEQIA TAGASALSLN AIAKQMGMSG PALYRYFANR        60
     DELITALIRD AYQSMADAMR AAVADGAGLR GLARTLREWA LEDPQRYLLI YGTPVPGYQA       120
     PEDTTRLAND VMALLLDASS AEGLGALPPS PVQTHLEQHS PWAGAHAGEG TTLHRAVILW       180
     TRLHGVLSLE LAGHFAGMEF DPALLYAAEV EAVAGY                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page