(data stored in ACNUC7421 zone)

EMBL: CP001700.PE379

CP001700.PE379       Location/Qualifiers
FT   CDS             424024..425055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0381"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sma:SAV_1467 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69334"
FT                   /db_xref="GOA:C7PVH8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH8"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACU69334.1"
FT                   /translation="MTDQTLVQVVLPGKVEPEDLQVQHAAVPQPAVGQVVIAMEATGVS
FT                   FAEQQMRRGRYFDQPPFPFVPGYDVVGRVYAVGAGVDPGLLGRRVAVLTKVGGWASHVL
FT                   ADARDAVEVPEGLTAEQAETVVVNGITAWQMLHRRARVKAGQTVLVHGVNGGVGSVLAQ
FT                   LAMAAGATVIGTASARHHDALRAAGILPVDYRAGNVPEQVRALAPHGVDAVFDHVGGRS
FT                   VIDSWHLLAPGGTLVSYGSASTRDDSGWKQWPVLKILARTTLWTLLPNGRSASFFNIWA
FT                   GKKLNQDRFRARLRADLTEVFAALGRGDIVTTIAARLPLAQAGEAMRLAESGTVAGKII
FT                   LTP"
     MTDQTLVQVV LPGKVEPEDL QVQHAAVPQP AVGQVVIAME ATGVSFAEQQ MRRGRYFDQP        60
     PFPFVPGYDV VGRVYAVGAG VDPGLLGRRV AVLTKVGGWA SHVLADARDA VEVPEGLTAE       120
     QAETVVVNGI TAWQMLHRRA RVKAGQTVLV HGVNGGVGSV LAQLAMAAGA TVIGTASARH       180
     HDALRAAGIL PVDYRAGNVP EQVRALAPHG VDAVFDHVGG RSVIDSWHLL APGGTLVSYG       240
     SASTRDDSGW KQWPVLKILA RTTLWTLLPN GRSASFFNIW AGKKLNQDRF RARLRADLTE       300
     VFAALGRGDI VTTIAARLPL AQAGEAMRLA ESGTVAGKII LTP                         343
//

If you have problems or comments...

PBIL Back to PBIL home page