(data stored in ACNUC7421 zone)

EMBL: CP001700.PE38

CP001700.PE38        Location/Qualifiers
FT   CDS             40430..42532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0038"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: sgr:SGR_3725
FT                   putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68993"
FT                   /db_xref="GOA:C7QFQ4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ4"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU68993.1"
FT                   /translation="MSGTYPGAEQPRRLGGRYELGAVLGRGGMAEVFMARDTRLGRTVA
FT                   VKTLRADLSRDPTFQARFRREAQSAASLNHPAIVAIYDTGEDFENGVSVPYIVMEYADG
FT                   STLRDLLHSGRRLLPERALEITAGVLQALDYSHRNGIIHRDIKPANIMLTRSGTVKVMD
FT                   FGIARAMADNGMTMTQTAAVIGTAQYLSPEQAKGETVDARSDLYSTGCLMFELLTGRPP
FT                   FVGDSPVAVAYQHVREEPQPPSSYDPEVSPAIDAVVLKSLAKTADARYQSATEMRADIE
FT                   RVLDGRPTEAQTAVLGAANMPTQRLDPRQVGAAAAVGQTRAMPAVDTPTGYQSPAPRYE
FT                   EGLDGPGGRPPGPPRRAEPRRAPEPEKSGRTGYIILAIAGIAAVIAAILLAKSLLKSGG
FT                   NASSKAAPDFGIGVKTFPQAQQMLAQPDYTGFSLTGSGKDCPPGTDVHSGNAGTIIAQS
FT                   PAAGAYGKPGPITYCLSLGPQNGKVPPKATLNGMNQDQLKAYLGGAHFDLANPLITSQP
FT                   DPKVLAGNIIDVIDAGNNNAVLDGQQVPDVSKVQIGWIVSAGPSKIPLSTQGYIGQPYN
FT                   SVVSQIQGLGFTNVKPVVDNPGGNLPAGSVTRISPGDNSYTADTPIVVYYAPQPVAPTT
FT                   PTSSQSQGCDPNQDPTCQQNPTSTASGPGNGQTSSNPMLCVVDPNAPGCPNAPTTSKKG
FT                   GGGGGN"
     MSGTYPGAEQ PRRLGGRYEL GAVLGRGGMA EVFMARDTRL GRTVAVKTLR ADLSRDPTFQ        60
     ARFRREAQSA ASLNHPAIVA IYDTGEDFEN GVSVPYIVME YADGSTLRDL LHSGRRLLPE       120
     RALEITAGVL QALDYSHRNG IIHRDIKPAN IMLTRSGTVK VMDFGIARAM ADNGMTMTQT       180
     AAVIGTAQYL SPEQAKGETV DARSDLYSTG CLMFELLTGR PPFVGDSPVA VAYQHVREEP       240
     QPPSSYDPEV SPAIDAVVLK SLAKTADARY QSATEMRADI ERVLDGRPTE AQTAVLGAAN       300
     MPTQRLDPRQ VGAAAAVGQT RAMPAVDTPT GYQSPAPRYE EGLDGPGGRP PGPPRRAEPR       360
     RAPEPEKSGR TGYIILAIAG IAAVIAAILL AKSLLKSGGN ASSKAAPDFG IGVKTFPQAQ       420
     QMLAQPDYTG FSLTGSGKDC PPGTDVHSGN AGTIIAQSPA AGAYGKPGPI TYCLSLGPQN       480
     GKVPPKATLN GMNQDQLKAY LGGAHFDLAN PLITSQPDPK VLAGNIIDVI DAGNNNAVLD       540
     GQQVPDVSKV QIGWIVSAGP SKIPLSTQGY IGQPYNSVVS QIQGLGFTNV KPVVDNPGGN       600
     LPAGSVTRIS PGDNSYTADT PIVVYYAPQP VAPTTPTSSQ SQGCDPNQDP TCQQNPTSTA       660
     SGPGNGQTSS NPMLCVVDPN APGCPNAPTT SKKGGGGGGN                             700
//

If you have problems or comments...

PBIL Back to PBIL home page