(data stored in ACNUC7421 zone)

EMBL: CP001700.PE380

CP001700.PE380       Location/Qualifiers
FT   CDS             425100..425504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0382"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   ana:alr3729 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69335"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="PDB:4H3U"
FT                   /db_xref="PDB:4HVN"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH9"
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /protein_id="ACU69335.1"
FT                   /translation="MTTPEIVTAWAAAWTGTNPNALGTLFAADGTYVDHAIGATMTGRE
FT                   QISGWKARTDAMIENVHVTITKAYRAGDHVTIEAVYGGHIKGAPTPFAVPMATLLRTRG
FT                   EEITSDQDYYSLSSVLAQSGLPADWTPSDS"
     MTTPEIVTAW AAAWTGTNPN ALGTLFAADG TYVDHAIGAT MTGREQISGW KARTDAMIEN        60
     VHVTITKAYR AGDHVTIEAV YGGHIKGAPT PFAVPMATLL RTRGEEITSD QDYYSLSSVL       120
     AQSGLPADWT PSDS                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page