(data stored in ACNUC7421 zone)

EMBL: CP001700.PE381

CP001700.PE381       Location/Qualifiers
FT   CDS             complement(425684..426577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0383"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: sma:SAV_7306 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69336"
FT                   /db_xref="GOA:C7PVI0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU69336.1"
FT                   /translation="MQFHQLRYFIAVAETRHFTRAAEALHVTQPSLSQQIRALEHELGA
FT                   DLFLRARGNITLTDAGEALLPMARRILADADAARREVQELAELRRGHVRLGATPSLCTG
FT                   LLPDVLRTYHRRYPGIQLLVQESGSHDLVRDLARGALDLALVVLPLPSPSPALTTEELL
FT                   REDLVVVSAPNLPPPGDGRQVRIADLEHEQLIMFRHGYDLRDLTVAACRAQGFEPVFAI
FT                   EGGEMDAVLGFARAGLGVAIVPSMVAQNVDPSLRVTPIAPPALHRTIALAHRTDVALPR
FT                   AAQEFRRTLLERTTAE"
     MQFHQLRYFI AVAETRHFTR AAEALHVTQP SLSQQIRALE HELGADLFLR ARGNITLTDA        60
     GEALLPMARR ILADADAARR EVQELAELRR GHVRLGATPS LCTGLLPDVL RTYHRRYPGI       120
     QLLVQESGSH DLVRDLARGA LDLALVVLPL PSPSPALTTE ELLREDLVVV SAPNLPPPGD       180
     GRQVRIADLE HEQLIMFRHG YDLRDLTVAA CRAQGFEPVF AIEGGEMDAV LGFARAGLGV       240
     AIVPSMVAQN VDPSLRVTPI APPALHRTIA LAHRTDVALP RAAQEFRRTL LERTTAE          297
//

If you have problems or comments...

PBIL Back to PBIL home page